DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp4f17

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001094915.1 Gene:Cyp4f17 / 208285 MGIID:3646233 Length:524 Species:Mus musculus


Alignment Length:467 Identity:140/467 - (29%)
Similarity:234/467 - (50%) Gaps:57/467 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 WIG-YYSNIMVTNPKYMEFILSSQTLISKSDV--YDLTHPWLGLGLLTSTGSKWHKHRKMITPAF 135
            ||| :|..:.:.:||::..||.:...::..::  |....||||.|||.|.|.||.:||.::||||
Mouse    91 WIGPFYPILRLIHPKFIGPILQASAAVAPKEMIFYGFLKPWLGDGLLVSAGEKWSRHRHLLTPAF 155

  Fly   136 HFNILQDFHEVMNENSTKFIDQLKKVADGGN-IFDFQEEAHYLTLDVICDTAMGVSINAMENRSS 199
            ||:||:.:.:..|::......:.:::...|. ..|..|....:|||.:.:.......|..|: .|
Mouse   156 HFDILKPYMKNFNKSVNIMHAKWQRLTTKGTACLDMLEHISLMTLDSLQNCVFSFDSNCQES-PS 219

  Fly   200 SVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQDFTNEIIAKRIEVRKSGLEV 264
            ..:.|.::::..|..|...|:....:|::...:...:.|....:.:||:.:|.:|.....|.   
Mouse   220 EYIAAIQELSSLIVKRHHQPFLYLDFLYYCTADGRRFRKACDLVHNFTDAVIRERRRTLSSQ--- 281

  Fly   265 GIKADEFSRKK-----MAFLDTLLSSKVD-GRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLL 323
              ..|||.:.|     :.|:|.||.:|.: |:.|:.:::..|..||||.|||||.|.:.:.:|.|
Mouse   282 --NLDEFLKSKTKSKTLDFIDVLLLAKDEHGKELSDEDIRAEADTFMFGGHDTTASALSWILYNL 344

  Fly   324 SRHPDEQEKLFNEQCDVMGASGLGR---DATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKD 385
            :|||:.||:...|..:::    .||   :..:.:::.:..|.:.|||:.||:|.|..|.|...:|
Mouse   345 ARHPEYQERCRQEVQELL----RGREPQEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQD 405

  Fly   386 YVI-DGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERFDREKP---GPFEYVPFSAGPRNCIG 446
            .|: ||.::||||...:.:..:.:|..|:.||..:.|.|||.|.|   .|..::|||||||||||
Mouse   406 VVLPDGRVIPKGTDCVISIFGVHHNPEVWPDPEVYDPFRFDPENPQKRSPLAFIPFSAGPRNCIG 470

  Fly   447 QKFALLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTLGLQPAEKKSRDAHNHKYDPILSASMT 511
            |.||:.|:|..::..:..|.|||...|                              |.....:.
Mouse   471 QTFAMREMKVALALTLLRFRVLPGDKE------------------------------PRRKPELI 505

  Fly   512 LKSENGLHLRMK 523
            |::|.||.||::
Mouse   506 LRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 130/411 (32%)
Cyp4f17NP_001094915.1 p450 52..515 CDD:365848 138/463 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845194
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.