DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp4f13

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_570952.1 Gene:Cyp4f13 / 170716 MGIID:2158641 Length:523 Species:Mus musculus


Alignment Length:465 Identity:137/465 - (29%)
Similarity:235/465 - (50%) Gaps:54/465 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 WIG-YYSNIMVTNPKYMEFILSSQTLISKSD--VYDLTHPWLGLGLLTSTGSKWHKHRKMITPAF 135
            |:| .|..:.:.:|.::..:|.:...::..:  :|....||||.|||.|.|.||..||:::||||
Mouse    91 WVGPVYPILRLVHPNFIAPLLQASAAVAPKEMTLYGFLKPWLGDGLLMSAGDKWSHHRRLLTPAF 155

  Fly   136 HFNILQDFHEVMNENSTKFIDQLKKVAD-GGNIFDFQEEAHYLTLDVICDTAMGVSINAMENRSS 199
            ||:||:.:.::.|::......:.:.:|. |.:..|..|....:|||.:......|..|..|: .|
Mouse   156 HFDILKSYVKIFNKSVNIMHAKWQCLASKGTSRLDMFEHISLMTLDSLQKCIFSVDSNCQES-DS 219

  Fly   200 SVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQDFTNEII-AKRIEVRKSGLE 263
            ..:.|..:::..:..|...|:.....|::...:...:.|....:.:||:.:| .:|..:...|:|
Mouse   220 KYIAAILELSSLVVKRHRQPFLYLDLLYYLTADGRRFRKACDLVHNFTDAVIKERRSTLNTQGVE 284

  Fly   264 VGIKADEFSRKKMAFLDTLLSSKVD-GRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHP 327
            . :|| :...|.:.|:|.||.::.: |:.|:::::..|..||||.|||||||.:.:.:|.|:|||
Mouse   285 F-LKA-KAKTKTLDFIDVLLMAEDEHGKGLSNEDIRAEADTFMFGGHDTTTSALSWILYNLARHP 347

  Fly   328 DEQEKLFNEQCDVMGASGLGRDATFQEI-----STMKHLDLFIKEAQRLYPSVPFIGRFTEKDYV 387
            :.||:...|..:::      ||...:||     :.:..|.:.|||:.||:|.|..|.|...:|.:
Mouse   348 EYQERCRQEVQELL------RDRDSEEIEWDDLAQLPFLTMCIKESLRLHPPVLLISRCCTQDVL 406

  Fly   388 I-DGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERFDREKP---GPFEYVPFSAGPRNCIGQK 448
            : ||..:|||....:.:..:.:|..|:.||..:.|.|||.|.|   .|..::|||||.||||||.
Mouse   407 LPDGRAIPKGNICVISIFGVHHNPSVWPDPEVYNPFRFDPENPQKRSPLAFIPFSAGTRNCIGQT 471

  Fly   449 FALLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTLGLQPAEKKSRDAHNHKYDPILSASMTLK 513
            ||:.|||..::..:..|.:||  |:                            .:|.....:.|:
Mouse   472 FAMSEIKVALALTLLRFRILP--DD----------------------------KEPRRKPELILR 506

  Fly   514 SENGLHLRMK 523
            :|.||.||::
Mouse   507 AEGGLWLRVE 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 127/409 (31%)
Cyp4f13NP_570952.1 p450 52..513 CDD:278495 135/460 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.