DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and CYP4A11

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:535 Identity:157/535 - (29%)
Similarity:261/535 - (48%) Gaps:66/535 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AFLALPLFLVTYFELGLLRR--KRMLNKFQGPSMLPLVGNAHQMGNTPTEILNRFFGWWHEYGKD 69
            :.|.|.|.|:...:|.|.|:  .:.|.:|..|....|.|:..::  ...:.|.|...|...: ..
Human    23 SLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQEL--QQDQELQRIQKWVETF-PS 84

  Fly    70 NFRYWI-GYYSNIMVTNPKYMEFILSSQTLISKSD-----VYDLTHPWLGLGLLTSTGSKWHKHR 128
            ...:|: |....:.:.:|.||:.||      .:||     .|....||:|.|||...|..|.:||
Human    85 ACPHWLWGGKVRVQLYDPDYMKVIL------GRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHR 143

  Fly   129 KMITPAFHFNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLDVI--CDTAMGVSI 191
            :|:|||||::||:.:..:|.::....:|:.:::....:..:..:....:|||.|  |..:...||
Human   144 RMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSI 208

  Fly   192 NAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQDFTNEIIAKRIE 256
            . ::..|.|.:||..|:...:..|..:.:.:|..::..........:..:.....|:::    |:
Human   209 Q-VDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQV----IQ 268

  Fly   257 VRKSGLEVGIKADEFSRKK-MAFLDTLLSSKVD-GRPLTSQELYEEVSTFMFEGHDTTTSGVGFA 319
            :||:.|:...:.::..||: :.|||.||.:|:: |..|:.::|..||.||||||||||.||:.:.
Human   269 LRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWI 333

  Fly   320 VYLLSRHPDEQEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEK 384
            :|.|:.||..||:...|...::|.   |...|:..:..|.:..:.||||.||||.||.|||....
Human   334 LYALATHPKHQERCREEIHSLLGD---GASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELST 395

  Fly   385 DYVI-DGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERFDREKPGPFE----YVPFSAGPRNC 444
            .... ||..:|||..:.|.:..|.:|.:|:.:|..|.|.||   .||..:    ::|||.|.|||
Human   396 PVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRF---APGSAQHSHAFLPFSGGSRNC 457

  Fly   445 IGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTLGLQPAEKKSRDAHNHKYDPILSAS 509
            ||::||:.|:|...:..:..||:||....:                             ||..|.
Human   458 IGKQFAMNELKVATALTLLRFELLPDPTRI-----------------------------PIPIAR 493

  Fly   510 MTLKSENGLHLRMKQ 524
            :.|||:||:|||:::
Human   494 LVLKSKNGIHLRLRR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 135/449 (30%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 146/501 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154754
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.