DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and cyp-31A5

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans


Alignment Length:265 Identity:80/265 - (30%)
Similarity:127/265 - (47%) Gaps:17/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWIVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSMLPLVGNAHQMGNTPTEILNRFFGWWHE 65
            |.:::.|.|.....::.:.....||.:::|.....|...|:||:.......|...:|:..|..:.
 Worm     1 MGVIIPAVLLASATVIAWLIYKHLRMRQVLKHLNQPRSYPIVGHGLITKPDPEGFMNQVIGMGYL 65

  Fly    66 YGKDNF-RYWIGYYSNIMVTNPKYMEFILSSQTLISKSDVYDLTHPWLGLGLLTSTGSKWHKHRK 129
            |..... ..|||.:..:|:.:...:|.|.||...::|...|.|..||||:.:|||...:|...||
 Worm    66 YPDPRMCLLWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTSQKEQWRPKRK 130

  Fly   130 MITPAFHFNILQDFHEVMNENSTKFIDQL--KKVADGGNIFDFQEEAHYL------TLDVICDTA 186
            ::||.||::||:||..:.||.|...|.:|  ..|||        ||...|      |||:||:|:
 Worm   131 LLTPTFHYDILKDFLPIFNEQSKILIQKLCCLGVAD--------EEVDVLSVITLCTLDIICETS 187

  Fly   187 MGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQDFTNEII 251
            ||.:|.|....::..|.|...|...|..|..:|...|.::::...:...:.|.|..|.|||.::|
 Worm   188 MGKAIGAQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLHILHDFTKKVI 252

  Fly   252 AKRIE 256
            .:|.|
 Worm   253 VERKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 74/232 (32%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 74/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.