DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus


Alignment Length:469 Identity:123/469 - (26%)
Similarity:209/469 - (44%) Gaps:70/469 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FFGWWHEYGKDNFRYWIGYYSNIMVTNPKYMEFILSSQTLISKSDVYDLTHP-----WLGLGLLT 118
            |..|..:|| ...|..:.|.::::||:|:.::..|.|......|.:|.....     ..|.||::
Mouse    64 FLDWAKKYG-PVVRVNVFYKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVS 127

  Fly   119 STG-SKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLDVI 182
            ... .:|:|.||::..||..:.|....|..||.:.:.::.|:..|||......|:.....|:|::
Mouse   128 ECDYGRWYKQRKVMDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTCATIDIL 192

  Fly   183 CDTAMGVSINAMENRSSSVVQAFKDITYTIK-----MRAFSPWKRNKYLFHFAPEYPEYSKTLKT 242
            ...|.|:..:.:......:.||.|.:...|.     :..|.|.||.        :..|..::::.
Mouse   193 AKAAFGMETSMLLGAQKPLSQAVKVMLEGISASRNTLAKFMPGKRK--------QLREIRESIRL 249

  Fly   243 LQDFTNEIIAKRIEVRKSGLEVG-------IKADEFSRKKMAFLDTLLSSKVDGRPLTSQELYEE 300
            |:....:.:.:|.|..|.|.::.       :||:|.::.....||..:                 
Mouse   250 LRQVGKDWVQRRREALKRGEDMPADILTQILKAEEGAQDDEVLLDNFV----------------- 297

  Fly   301 VSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFI 365
              ||...||:|:.:.:.|.|..|||.|:...:|..|..:|:|:.   |...::::..:::|...:
Mouse   298 --TFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVVGSK---RHLDYEDLGRLQYLSQVL 357

  Fly   366 KEAQRLYPSVPFIGRFTEKDYVIDGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERFDREKPG 430
            ||:.||||......|..|::.:|||..||..|.|.....::|..|..|:||..|.|:||....|.
Mouse   358 KESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPK 422

  Fly   431 P-FEYVPFSAGPRNCIGQKFALLEIKTVVSKIIR--NFEVLPALDELVSKDGYISTTLGLQPAEK 492
            | |.|.|||.|.|:||||:||.:|:|.|::|:::  .|.::|            ....|||    
Mouse   423 PRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRIEFRLVP------------GQRFGLQ---- 471

  Fly   493 KSRDAHNHKYDPIL 506
              ..|.....||:|
Mouse   472 --EQATLKPLDPVL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 115/430 (27%)
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 116/444 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.