DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r and crispld1

DIOPT Version :10

Sequence 1:NP_524770.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:187 Identity:51/187 - (27%)
Similarity:78/187 - (41%) Gaps:31/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DNNGAWASSCPSDATLLTLSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLA 100
            |.:|.|.::.......:|  .::...::...|:.|..:       ...|..|..:.|:.||...|
 Frog    41 DEDGEWWTAKHRGKRAIT--ESDMKLILDLHNKLRGEV-------YPPASNMEFMIWDVELERSA 96

  Fly   101 SLNVKSCQMKHDGCHNTDAFDWSGQNL-AWMGYYNPLNVTHYLEWGVDMWYDEA-----VYTKQA 159
            ....::|..:|.   ..|.....|||| |..|.|.|  .|::    |..||||.     .|.::.
 Frog    97 EAWAETCLWEHG---PADLLPVIGQNLGAHWGRYRP--PTYH----VQAWYDEVRDYTFPYPQEC 152

  Fly   160 YIDAY-PSNYNGPAIGHFTVLVADRNTEVGCA---AATYSVSGQSY-KAFLLACNYA 211
              |.| |...:||...|:|.||...::.:|||   ....:|.||.: ||..|.|||:
 Frog   153 --DPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYLVCNYS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5rNP_524770.1 CAP_euk 59..211 CDD:349399 46/162 (28%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 46/162 (28%)
LCCL 304..388 CDD:128866
LCCL 407..505 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.