DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK29

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_974150.2 Gene:CPK29 / 843936 AraportID:AT1G76040 Length:561 Species:Arabidopsis thaliana


Alignment Length:354 Identity:109/354 - (30%)
Similarity:162/354 - (45%) Gaps:46/354 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGYGINGKVVQCTHRRTQQNYALKVL--------LDSERARREVDLHWRVSGCRYIVNIIDVYEN 82
            ||.|..|...:||.:...:.||.|.:        .|.|..||||.:...::|...||.....|| 
plant   118 LGRGQFGITYKCTDKSNGREYACKSISKRKLIRRKDIEDVRREVMILQHLTGQPNIVEFRGAYE- 181

  Fly    83 TFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPEN 147
               |:..|.:|||...|||||.||..|  |:::|:|||.|..:|...|...|...:.||||||||
plant   182 ---DKDNLHLVMELCSGGELFDRIIKK--GSYSEKEAANIFRQIVNVVHVCHFMGVVHRDLKPEN 241

  Fly   148 LLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVVMYII 212
            .|..:.:.::.:|.||||.:.........:....:.|||||||| ...|.|..|:||.||::||:
plant   242 FLLVSNEEDSPIKATDFGLSVFIEEGKVYRDIVGSAYYVAPEVL-HRNYGKEIDVWSAGVMLYIL 305

  Fly   213 MCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRIQDVIS 277
            :.|.|||:......|.    ..|..|:.|.....|..:|::|||||:.||..||.||:...:.:.
plant   306 LSGVPPFWGETEKTIF----EAILEGKLDLETSPWPTISESAKDLIRKMLIRDPKKRITAAEALE 366

  Fly   278 NKWIA------------------QYNAVPQTPLCTGRMLKEAEETWPEVQEEMTRSL--ATMRVD 322
            :.|:.                  |:.|:.:......:::.|      .:.||..:.|  ....:|
plant   367 HPWMTDTKISDKPINSAVLVRMKQFRAMNKLKKLALKVIAE------NLSEEEIKGLKQTFKNMD 425

  Fly   323 YDQMQIKALDKSNNPLLTKRRKKIEEMEL 351
            .|:......|:..|. |.:...|:.|.|:
plant   426 TDESGTITFDELRNG-LHRLGSKLTESEI 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 94/261 (36%)
S_TKc 25..281 CDD:214567 94/262 (36%)
CPK29NP_974150.2 S_TKc 112..370 CDD:214567 94/262 (36%)
STKc_CAMK 112..369 CDD:270687 94/261 (36%)
PTZ00184 405..548 CDD:185504 12/56 (21%)
EFh 417..476 CDD:238008 9/38 (24%)
EFh 489..549 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.