DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK19

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_176386.2 Gene:CPK19 / 842490 AraportID:AT1G61950 Length:551 Species:Arabidopsis thaliana


Alignment Length:355 Identity:117/355 - (32%)
Similarity:175/355 - (49%) Gaps:44/355 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGYGINGKVVQCTHRRTQQNYALKVLL--------DSERARREVDLHWRVSGCRYIVNIIDVYEN 82
            ||.|..|....||...:.:|:|.|.:|        |.|..|||:.:...:||...||.|...|| 
plant   104 LGRGQFGITYICTEISSGKNFACKSILKRKLIRTKDREDVRREIQIMHYLSGQPNIVEIKGAYE- 167

  Fly    83 TFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPEN 147
               ||:.:.:|||..||||||.:|..:  |.::|:.||:|:..:...|...|...:.||||||||
plant   168 ---DRQSVHLVMELCEGGELFDKITKR--GHYSEKAAAEIIRSVVKVVQICHFMGVIHRDLKPEN 227

  Fly   148 -LLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVVMYI 211
             ||.:..:.::.||.||||.:.........:....:.|||||||| ...|.|:.||||.||::||
plant   228 FLLSSKDEASSMLKATDFGVSVFIEEGKVYEDIVGSAYYVAPEVL-KRNYGKAIDIWSAGVILYI 291

  Fly   212 IMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRIQDVI 276
            ::||.|||::.    ...|:...|..|:.||....|.::|::||||::.||..||.||.....|:
plant   292 LLCGNPPFWAE----TDKGIFEEILRGEIDFESEPWPSISESAKDLVRNMLKYDPKKRFTAAQVL 352

  Fly   277 SNKWIAQYNAVPQTPL---CTGRM--------LKEAEETW--PEVQEEMTRSLATM--------- 319
            .:.||.:.......|:   ...||        ||:....:  ..::||..:.|.||         
plant   353 EHPWIREGGEASDKPIDSAVLSRMKQLRAMNKLKKLAFKFIAQNLKEEELKGLKTMFANMDTDKS 417

  Fly   320 -RVDYDQMQIKALDKSNNPLLTKRRKKIEE 348
             .:.||::: ..|:|..:.|.....|::.|
plant   418 GTITYDELK-SGLEKLGSRLTETEVKQLLE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 98/262 (37%)
S_TKc 25..281 CDD:214567 98/263 (37%)
CPK19NP_176386.2 STKc_CAMK 97..356 CDD:270687 98/262 (37%)
Pkinase 98..357 CDD:278497 98/263 (37%)
PTZ00184 393..538 CDD:185504 12/55 (22%)
EFh 405..464 CDD:238008 10/43 (23%)
EFh 477..537 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.