DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and SNRK2.10

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_176290.1 Gene:SNRK2.10 / 842385 AraportID:AT1G60940 Length:361 Species:Arabidopsis thaliana


Alignment Length:335 Identity:93/335 - (27%)
Similarity:147/335 - (43%) Gaps:79/335 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NYALKVLLDSERARREVDLHWRVSG-------CRYIVNIIDV-YENTFKDRKCLL------VVME 95
            |:.:..|:..:.::..|.:.:...|       .|.|:|...: :.|..:.::.:|      :.||
plant    14 NFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNIIRFKEVVLTPTHIAIAME 78

  Fly    96 CMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPENLLYTTTQPNATLK 160
            ...|||||:||  .:.|.|:|.||.....::.:.|.|.|:..|.|||||.||.|...: |...||
plant    79 YAAGGELFERI--CSAGRFSEDEARYFFQQLISGVSYCHAMQICHRDLKLENTLLDGS-PAPRLK 140

  Fly   161 LTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYD-KSCDIWSLGVVMYIIMCGFPPFYSNHG 224
            :.|||::|.:......::...||.|:|||||...:|| |..|:||.||.:|:::.|..||.... 
plant   141 ICDFGYSKSSLLHSMPKSTVGTPAYIAPEVLSRGEYDGKMADVWSCGVTLYVMLVGAYPFEDQE- 204

  Fly   225 LAISPGMKN------RIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRIQDVISNKW--- 280
               .|  ||      ||...:|..||  :.::||..|.|:..:...:.:||:.|.|:..:.|   
plant   205 ---DP--KNFKKTIQRIMAVKYKIPD--YVHISQDCKHLLSRIFVTNSNKRITIGDIKKHPWFLK 262

  Fly   281 --------IAQ------------YNAVPQ---------TPLCTGRML---------------KEA 301
                    |||            ..:|.:         ||....|.:               ::|
plant   263 NLPRELTEIAQAAYFRKENPTFSLQSVEEIMKIVEEAKTPARVSRSIGAFGWGGGEDAEGKEEDA 327

  Fly   302 EETWPEVQEE 311
            ||...||:||
plant   328 EEEVEEVEEE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 78/255 (31%)
S_TKc 25..281 CDD:214567 79/267 (30%)
SNRK2.10NP_176290.1 STKc_SnRK2 3..259 CDD:271132 78/255 (31%)
S_TKc 4..260 CDD:214567 78/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.