DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CDPK2

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_174807.1 Gene:CDPK2 / 840471 AraportID:AT1G35670 Length:495 Species:Arabidopsis thaliana


Alignment Length:368 Identity:120/368 - (32%)
Similarity:177/368 - (48%) Gaps:43/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NQRQPKT------TPLTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVL--------LDSER 56
            |.|:|..      ||...|:......||.|..|....||.:.|..|||.|.:        .|.|.
plant     6 NPRRPSNTVLPYQTPRLRDHYLLGKKLGQGQFGTTYLCTEKSTSANYACKSIPKRKLVCREDYED 70

  Fly    57 ARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQ 121
            ..||:.:...:|....:|.|    :.|::|...:.:|||..||||||.||..|  |.|:||||.:
plant    71 VWREIQIMHHLSEHPNVVRI----KGTYEDSVFVHIVMEVCEGGELFDRIVSK--GHFSEREAVK 129

  Fly   122 IMHEICAAVDYLHSRDIAHRDLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYV 186
            ::..|...|:..||..:.||||||||.|:.:.:.:|.||.||||.:........|.....:||||
plant   130 LIKTILGVVEACHSLGVMHRDLKPENFLFDSPKDDAKLKATDFGLSVFYKPGQYLYDVVGSPYYV 194

  Fly   187 APEVL----GPEKYDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEW 247
            |||||    |||     .|:||.||::||::.|.|||::.    ...|:..:|..|:.||....|
plant   195 APEVLKKCYGPE-----IDVWSAGVILYILLSGVPPFWAE----TESGIFRQILQGKLDFKSDPW 250

  Fly   248 TNVSQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQYNAVPQTPLCTGRMLKEAEETWPEVQEEM 312
            ..:|:||||||..||...|.||:...:.:.:.||....|.|..||....:.:..:.:.....::|
plant   251 PTISEAAKDLIYKMLERSPKKRISAHEALCHPWIVDEQAAPDKPLDPAVLSRLKQFSQMNKIKKM 315

  Fly   313 TRSLATMRVDYDQM-----QIKALDKSNNPLLTKRRKKIEEME 350
            ...:...|:..:::     ..|.:|..|:..:|     .||::
plant   316 ALRVIAERLSEEEIGGLKELFKMIDTDNSGTIT-----FEELK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 101/273 (37%)
S_TKc 25..281 CDD:214567 100/267 (37%)
CDPK2NP_174807.1 STKc_CAMK 25..283 CDD:270687 100/272 (37%)
Pkinase 26..284 CDD:278497 100/272 (37%)
PTZ00184 320..462 CDD:185504 7/39 (18%)
EFh 332..391 CDD:238008 6/27 (22%)
EFh 404..463 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.