DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and PEPKR1

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_172719.1 Gene:PEPKR1 / 837815 AraportID:AT1G12580 Length:522 Species:Arabidopsis thaliana


Alignment Length:277 Identity:92/277 - (33%)
Similarity:146/277 - (52%) Gaps:20/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVLL--------DSERARREVDLHWRVSGCR 71
            |.|.||.... ||:|..|.:..|:.:.|.:..|.|.:.        |.:..:.|:.:..:::|..
plant    40 LKDRYVLGEQ-LGWGQFGVIRVCSDKLTGERLACKSISKDRLVTQDDMKSIKLEIAIMAKLAGHP 103

  Fly    72 YIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSR 136
            .:||:..|||    ::..:.:|||...|||||.:::..  |.::|..|..:...:...|.:.|..
plant   104 NVVNLKAVYE----EKDSVHLVMELCAGGELFHKLEKY--GRYSEVRARVLFKHLMQVVKFCHDS 162

  Fly   137 DIAHRDLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCD 201
            .|.||||||||:|..|...::.:||.|||.|........|.....:|:|:|||||. ..|:::.|
plant   163 GIVHRDLKPENILMATMSSSSPIKLADFGLATYIKPGEKLSGTVGSPFYIAPEVLA-GGYNQAAD 226

  Fly   202 IWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDP 266
            :||.||::||::.|.|||:......|.    :.:|.....|....|.|::..|||||:|||.|||
plant   227 VWSAGVILYILLSGAPPFWGKTKSKIF----DAVRAADLRFSAEPWDNITSYAKDLIRGMLCVDP 287

  Fly   267 SKRLRIQDVISNKWIAQ 283
            |:||...:|:::.|:.|
plant   288 SQRLSADEVLAHSWMEQ 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 88/269 (33%)
S_TKc 25..281 CDD:214567 86/263 (33%)
PEPKR1NP_172719.1 STKc_CAMK 43..301 CDD:270687 88/269 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.