DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK28

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_201422.1 Gene:CPK28 / 836753 AraportID:AT5G66210 Length:523 Species:Arabidopsis thaliana


Alignment Length:356 Identity:104/356 - (29%)
Similarity:167/356 - (46%) Gaps:39/356 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVLLDS--------ERARREVDLHWRVSGCRYIV 74
            |:.|...:||:|..|......||......|:|.|..|        |..:|||.:...:||...:|
plant    60 DHYTIGKLLGHGQFGYTYVAIHRPNGDRVAVKRLDKSKMVLPIAVEDVKREVQILIALSGHENVV 124

  Fly    75 NIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIA 139
            .    :.|.|:|...:.:|||..|||||..||..|....::|::||.::.::.......|...:.
plant   125 Q----FHNAFEDDDYVYIVMELCEGGELLDRILSKKGNRYSEKDAAVVVRQMLKVAGECHLHGLV 185

  Fly   140 HRDLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVL----GPEKYDKSC 200
            |||:||||.|:.:.|.::.||.||||.:..............:.||||||||    |||.     
plant   186 HRDMKPENFLFKSAQLDSPLKATDFGLSDFIKPGKRFHDIVGSAYYVAPEVLKRRSGPES----- 245

  Fly   201 DIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVD 265
            |:||:||:.||::||..||:..    ...|:...:...:.||....|..:|.:|||.:|.:|..|
plant   246 DVWSIGVITYILLCGRRPFWDR----TEDGIFKEVLRNKPDFSRKPWATISDSAKDFVKKLLVKD 306

  Fly   266 PSKRLRIQDVISNKWIAQYNAVPQTPLCTGRMLKEAEE--TWPEVQEEMTRSLATMRVDYDQM-- 326
            |..||.....:|:.|:.:.......|:... :|....:  .:..:::...|:||: .:|..::  
plant   307 PRARLTAAQALSHAWVREGGNATDIPVDIS-VLNNLRQFVRYSRLKQFALRALAS-TLDEAEISD 369

  Fly   327 ---QIKALDKSNNPLLTKRRKKIEEMELYMA 354
               |..|:|...|.:::     :|||...:|
plant   370 LRDQFDAIDVDKNGVIS-----LEEMRQALA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 89/273 (33%)
S_TKc 25..281 CDD:214567 87/267 (33%)
CPK28NP_201422.1 STKc_CAMK 61..321 CDD:270687 88/272 (32%)
FRQ1 346..502 CDD:227455 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.