DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and AT5G24430

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_197831.3 Gene:AT5G24430 / 832514 AraportID:AT5G24430 Length:594 Species:Arabidopsis thaliana


Alignment Length:332 Identity:109/332 - (32%)
Similarity:158/332 - (47%) Gaps:60/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSLQNQR----QPKTTPLTDDYVTSNTVL----------------GYGIN-------GKVVQCT 38
            |.:|:.:|    ||:..|:.:|   |..|:                |:|.|       ||.|...
plant    91 MAALRRRRGAPPQPRDEPIPED---SEDVVDHGGDSGGGERLDKNFGFGKNFEGKYELGKEVGRG 152

  Fly    39 H------------RRTQQNYALKVL--------LDSERARREVDLHWRVSGCRYIVNIIDVYENT 83
            |            :...|..|:|::        |..|..||||.|...:||.|::|...||||  
plant   153 HFGHTCWAKAKKGKMKNQTVAVKIISKAKMTSTLSIEDVRREVKLLKALSGHRHMVKFYDVYE-- 215

  Fly    84 FKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPENL 148
              |...:.||||..|||||..||..:. |.:.|.:|.:|:.:|.:|..:.|.:.:.||||||||.
plant   216 --DADNVFVVMELCEGGELLDRILARG-GRYPEVDAKRILVQILSATAFFHLQGVVHRDLKPENF 277

  Fly   149 LYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVVMYIIM 213
            |:|:...:|.||:.|||.:........|.....:.|||||||| ...|....|:||:||:.||::
plant   278 LFTSRNEDAILKVIDFGLSDFIRYDQRLNDVVGSAYYVAPEVL-HRSYSTEADMWSIGVISYILL 341

  Fly   214 CGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRIQDVISN 278
            ||..|||.....||   .:..:|... :|.|..|.::|..|||.:|.:||.|..||:.....:::
plant   342 CGSRPFYGRTESAI---FRCVLRANP-NFEDMPWPSISPTAKDFVKRLLNKDHRKRMTAAQALAH 402

  Fly   279 KWIAQYN 285
            .|:...|
plant   403 PWLRDEN 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 101/304 (33%)
S_TKc 25..281 CDD:214567 99/298 (33%)
AT5G24430NP_197831.3 STKc_CAMK 142..404 CDD:270687 95/271 (35%)
S_TKc 143..405 CDD:214567 95/271 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.