DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CDPK9

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_197748.1 Gene:CDPK9 / 832424 AraportID:AT5G23580 Length:490 Species:Arabidopsis thaliana


Alignment Length:299 Identity:113/299 - (37%)
Similarity:164/299 - (54%) Gaps:38/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTTPLTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVL--------LDSERARREVDLHWRV 67
            ||..:.|:|.... |||.|..|....|||::|.|..|.|.:        .|.:...||:.:...:
plant    14 KTKNVEDNYFLGQ-VLGQGQFGTTFLCTHKQTGQKLACKSIPKRKLLCQEDYDDVLREIQIMHHL 77

  Fly    68 SGCRYIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDY 132
            |....:|.|    |:.::|.|.:.:|||..||||||.||..:  |.::|||||:::..|...|:.
plant    78 SEYPNVVRI----ESAYEDTKNVHLVMELCEGGELFDRIVKR--GHYSEREAAKLIKTIVGVVEA 136

  Fly   133 LHSRDIAHRDLKPENLLYTTTQPNATLKLTDFGFA-----KETFTSYTLQTPCYTPYYVAPEVL- 191
            .||..:.||||||||.|::::..:|:||.||||.:     .|.|:...     .:.|||||||| 
plant   137 CHSLGVVHRDLKPENFLFSSSDEDASLKSTDFGLSVFCTPGEAFSELV-----GSAYYVAPEVLH 196

  Fly   192 ---GPEKYDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQA 253
               |||     ||:||.||::||::||||||::...:    |:..:|..|:.:|....|.::|::
plant   197 KHYGPE-----CDVWSAGVILYILLCGFPPFWAESEI----GIFRKILQGKLEFEINPWPSISES 252

  Fly   254 AKDLIKGMLNVDPSKRLRIQDVISNKWIAQYNAVPQTPL 292
            ||||||.||..:|.|||....|:.:.||......|..||
plant   253 AKDLIKKMLESNPKKRLTAHQVLCHPWIVDDKVAPDKPL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 105/278 (38%)
S_TKc 25..281 CDD:214567 104/272 (38%)
CDPK9NP_197748.1 STKc_CAMK 21..279 CDD:270687 105/278 (38%)
Pkinase 22..280 CDD:278497 105/278 (38%)
PTZ00184 316..458 CDD:185504
EFh 328..387 CDD:238008
EFh 400..459 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.