DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK34

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_197437.1 Gene:CPK34 / 832056 AraportID:AT5G19360 Length:523 Species:Arabidopsis thaliana


Alignment Length:373 Identity:127/373 - (34%)
Similarity:177/373 - (47%) Gaps:62/373 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DDYVTSNTV---LGYGINGKVVQCTHRRTQQNYALKVLL--------DSERARREVDLHWRVSGC 70
            :|..:|.|:   ||.|..|....||.:.|...:|.|.:.        |.|..||||.:...::|.
plant    62 EDVKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQ 126

  Fly    71 RYIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHS 135
            ..||.:...||    |:..:.:|||...|||||.||  .|.|.::||.||.::..|...:...||
plant   127 PNIVELKGAYE----DKHSVHLVMELCAGGELFDRI--IAKGHYSERAAASLLRTIVQIIHTCHS 185

  Fly   136 RDIAHRDLKPENLLYTTTQPNATLKLTDFG---FAK--ETFTSYTLQTPCYTPYYVAPEVLGPEK 195
            ..:.||||||||.|..:...|:.||.||||   |.|  |.|....     .:.||:||||| ..|
plant   186 MGVIHRDLKPENFLLLSKDENSPLKATDFGLSVFYKPGEVFKDIV-----GSAYYIAPEVL-RRK 244

  Fly   196 YDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKG 260
            |....||||:||::||::||.|||::..    ..|:.|.|.:||.||....|..:|..||||::.
plant   245 YGPEADIWSIGVMLYILLCGVPPFWAES----ENGIFNAILSGQVDFSSDPWPVISPQAKDLVRK 305

  Fly   261 MLNVDPSKRLRIQDVISNKWIAQYNAVPQTPLCTGRM--LKE--AEETWPEV---------QEEM 312
            |||.||.:||....|:::.||.:....|..||....|  ||:  |...:.:|         .||.
plant   306 MLNSDPKQRLTAAQVLNHPWIKEDGEAPDVPLDNAVMSRLKQFKAMNNFKKVALRVIAGCLSEEE 370

  Fly   313 TRSLATMRVDYDQMQIKALDKSNNPLLT---------KRRKKIEEMEL 351
            ...|..|        .|.:|..|:..:|         |:..::.|.|:
plant   371 IMGLKEM--------FKGMDTDNSGTITLEELRQGLAKQGTRLSEYEV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 106/277 (38%)
S_TKc 25..281 CDD:214567 103/271 (38%)
CPK34NP_197437.1 Pkinase 68..326 CDD:278497 104/273 (38%)
STKc_CAMK 68..325 CDD:270687 104/272 (38%)
PTZ00184 366..505 CDD:185504 11/53 (21%)
EFh 374..433 CDD:238008 9/45 (20%)
EFh 449..506 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.