DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK7

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_568281.1 Gene:CPK7 / 831123 AraportID:AT5G12480 Length:535 Species:Arabidopsis thaliana


Alignment Length:393 Identity:122/393 - (31%)
Similarity:179/393 - (45%) Gaps:66/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLQNQRQPKTTPL-TDDYVTSN--------TVL------------------GYGINGKVVQCTHR 40
            |.|.:.:.|..|. :::|.|::        :||                  |.|..|....||.:
plant    15 SKQGKPKNKNNPFYSNEYATTDRSGAGFKLSVLKDPTGHDISLQYDLGREVGRGEFGITYLCTDK 79

  Fly    41 RTQQNYA--------LKVLLDSERARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECM 97
            .|.:.||        |:..:|.|..||||::...:.....:|::.|    :|:|...:.:|||..
plant    80 ETGEKYACKSISKKKLRTAVDIEDVRREVEIMKHMPKHPNVVSLKD----SFEDDDAVHIVMELC 140

  Fly    98 EGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPENLLYTTTQPNATLKLT 162
            ||||||.||  .|.|.:|||.||.:|..|...|...|.:.:.||||||||.|:...:..:.||..
plant   141 EGGELFDRI--VARGHYTERAAAAVMKTIVEVVQICHKQGVMHRDLKPENFLFANKKETSALKAI 203

  Fly   163 DFG---FAK--ETFTSYTLQTPCYTPYYVAPEVL----GPEKYDKSCDIWSLGVVMYIIMCGFPP 218
            |||   |.|  |.|....     .:|||:|||||    |||     .|:||.||::||::||.||
plant   204 DFGLSVFFKPGEQFNEIV-----GSPYYMAPEVLRRNYGPE-----IDVWSAGVILYILLCGVPP 258

  Fly   219 FYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQ 283
            |::.    ...|:...|.....||....|..||.:||||::.||..||.|||....|:.:.||..
plant   259 FWAE----TEQGVAQAIIRSVIDFKRDPWPRVSDSAKDLVRKMLEPDPKKRLTAAQVLEHTWILN 319

  Fly   284 YNAVPQTPLCTGRMLKEAEETWPEVQEEMTRSLATMRVDYDQMQIKALDKSNNPLLTKRRKKIEE 348
            ....|...|  |..:|...:.:..:.:...|:|..:.......:...:.::...:...:|.||..
plant   320 AKKAPNVSL--GETVKARLKQFSVMNKLKKRALRVIAEHLSVEEAAGIKEAFEMMDVNKRGKINL 382

  Fly   349 MEL 351
            .||
plant   383 EEL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 105/304 (35%)
S_TKc 25..281 CDD:214567 103/290 (36%)
CPK7NP_568281.1 STKc_CAMK 58..316 CDD:270687 101/277 (36%)
FRQ1 356..503 CDD:227455 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.