DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK17

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_196779.1 Gene:CPK17 / 831091 AraportID:AT5G12180 Length:528 Species:Arabidopsis thaliana


Alignment Length:361 Identity:124/361 - (34%)
Similarity:169/361 - (46%) Gaps:59/361 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGYGINGKVVQCTHRRTQQNYALKVLL--------DSERARREVDLHWRVSGCRYIVNIIDVYEN 82
            ||.|..|....||.:.|...:|.|.:.        |.|..||||.:...::|...||.:...|| 
plant    79 LGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVELKGAYE- 142

  Fly    83 TFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPEN 147
               |:..:.:|||...|||||.||  .|.|.::||.||.::..|...|...||..:.||||||||
plant   143 ---DKHSVHLVMELCAGGELFDRI--IAKGHYSERAAASLLRTIVQIVHTCHSMGVIHRDLKPEN 202

  Fly   148 LLYTTTQPNATLKLTDFG---FAK--ETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGV 207
            .|......|:.||.||||   |.|  |.|....     .:.||:||||| ..||....||||:||
plant   203 FLLLNKDENSPLKATDFGLSVFYKPGEVFKDIV-----GSAYYIAPEVL-KRKYGPEADIWSIGV 261

  Fly   208 VMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRI 272
            ::||::||.|||::..    ..|:.|.|..|..||....|.::|..||||:|.|||.||.:||..
plant   262 MLYILLCGVPPFWAES----ENGIFNAILRGHVDFSSDPWPSISPQAKDLVKKMLNSDPKQRLTA 322

  Fly   273 QDVISNKWIAQYNAVPQTPLCTGRM--LKE--AEETWPEV---------QEEMTRSLATMRVDYD 324
            ..|:::.||.:....|..||....|  ||:  |...:.:|         .||....|..|     
plant   323 AQVLNHPWIKEDGEAPDVPLDNAVMSRLKQFKAMNNFKKVALRVIAGCLSEEEIMGLKEM----- 382

  Fly   325 QMQIKALDKSNNPLLT---------KRRKKIEEMEL 351
               .|.:|..::..:|         |:..::.|.|:
plant   383 ---FKGMDTDSSGTITLEELRQGLAKQGTRLSEYEV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 104/266 (39%)
S_TKc 25..281 CDD:214567 104/267 (39%)
CPK17NP_196779.1 STKc_CAMK 73..330 CDD:270687 104/266 (39%)
PTZ00184 371..510 CDD:185504 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.