DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK1

DIOPT Version :10

Sequence 1:NP_524769.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_196107.1 Gene:CPK1 / 830366 AraportID:AT5G04870 Length:610 Species:Arabidopsis thaliana


Alignment Length:167 Identity:39/167 - (23%)
Similarity:71/167 - (42%) Gaps:41/167 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LIISLVSFIATIPGGTLMIFYFFKDYSLSAQYGKTGLD---SFNFHRTIIAVMMITDALISFFTS 193
            :|||.|.::..:. .::..||::  ||     ||..:|   ..||.:::.....|.::|..:   
plant  3776 IIISTVDYLLRLQ-ESISDFYWY--YS-----GKEVIDESGQHNFSKSLAVTKQIFNSLTEY--- 3829

  Fly   194 LFTLYRLRKYKINYDKSL-------LLVTTFHIFPDVLVAMFNIDM-IFQVSGQSQFMNELSRM- 249
                  ::...|...:||       .:|...|:|.       |:.| :.|.|.|.:.:.||..: 
plant  3830 ------IQGPCIGNQQSLAHSRLWDAVVGFLHVFA-------NMQMKLSQDSSQIELLKELLDLL 3881

  Fly   250 --FLIFLVSFNSLTIVCTNRQIRKEYF-TLILSAGNV 283
              .::.|:|.....:|  |..|.|:.. ||:.|:.||
plant  3882 QDMVVMLLSLLEGNVV--NGTIGKQMVDTLVESSSNV 3916

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_524769.1 STKc_MAPKAPK 18..280 CDD:270991 36/162 (22%)
CPK1NP_196107.1 STKc_CAMK 149..407 CDD:270687
PTZ00184 444..586 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.