DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK18

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001190932.1 Gene:CPK18 / 829763 AraportID:AT4G36070 Length:561 Species:Arabidopsis thaliana


Alignment Length:357 Identity:103/357 - (28%)
Similarity:172/357 - (48%) Gaps:39/357 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVL--------LDSERARREVDLHWRVSGCRYI 73
            |:..|...:||:|..|.....|........|:|.:        ::.|..:|||.:...:.|...:
plant    68 DNRYTIGKLLGHGQFGFTYVATDNNNGNRVAVKRIDKAKMTQPIEVEDVKREVKILQALGGHENV 132

  Fly    74 VNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDI 138
            |.    :.|.|:|:..:.:|||..:||||..||..|.|..:||::||.::.::.......|.|.:
plant   133 VG----FHNAFEDKTYIYIVMELCDGGELLDRILAKKDSRYTEKDAAVVVRQMLKVAAECHLRGL 193

  Fly   139 AHRDLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVL----GPEKYDKS 199
            .|||:||||.|:.:|:..::||.||||.:.........|....:.||||||||    |||.    
plant   194 VHRDMKPENFLFKSTEEGSSLKATDFGLSDFIKPGVKFQDIVGSAYYVAPEVLKRRSGPES---- 254

  Fly   200 CDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNV 264
             |:||:||:.||::||..||:..    ...|:.|.:...:.||.:..|..:|..|||.:|.:|..
plant   255 -DVWSIGVITYILLCGRRPFWDK----TQDGIFNEVMRKKPDFREVPWPTISNGAKDFVKKLLVK 314

  Fly   265 DPSKRLRIQDVISNKWIAQYNAVPQTPLCTGRMLKEAEE--TWPEVQEEMTRSLATMRVDYDQM- 326
            :|..||.....:|:.|:.:.....:.|:... :|....:  .:..:::...|:|| ..::.|:: 
plant   315 EPRARLTAAQALSHSWVKEGGEASEVPIDIS-VLNNMRQFVKFSRLKQIALRALA-KTINEDELD 377

  Fly   327 ----QIKALDKSNNPLLTKRRKKIEEMELYMA 354
                |..|:|...|..::     :|||...:|
plant   378 DLRDQFDAIDIDKNGSIS-----LEEMRQALA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 87/273 (32%)
S_TKc 25..281 CDD:214567 86/267 (32%)
CPK18NP_001190932.1 STKc_CAMK 70..330 CDD:270687 87/272 (32%)
S_TKc 71..331 CDD:214567 87/272 (32%)
PTZ00184 367..514 CDD:185504 11/44 (25%)
EFh 378..437 CDD:238008 8/32 (25%)
EFh 459..513 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.