DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK5

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001329080.1 Gene:CPK5 / 829685 AraportID:AT4G35310 Length:556 Species:Arabidopsis thaliana


Alignment Length:354 Identity:114/354 - (32%)
Similarity:167/354 - (47%) Gaps:50/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TPLTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVLL--------DSERARREVDLHWRVSG 69
            ||...|..|.:..||.|..|....||...:..:||.|.:.        |.|..|||:.:...::|
plant    90 TPNIRDIYTLSRKLGQGQFGTTYLCTEIASGVDYACKSISKRKLISKEDVEDVRREIQIMHHLAG 154

  Fly    70 CRYIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLH 134
            ...||.|...||    |...:.:|||...|||||.||..:  |.::||:||::...|...|:..|
plant   155 HGSIVTIKGAYE----DSLYVHIVMELCAGGELFDRIIQR--GHYSERKAAELTKIIVGVVEACH 213

  Fly   135 SRDIAHRDLKPENLLYTTTQPNATLKLTDFG---FAK--ETFTSYTLQTPCYTPYYVAPEVLGPE 194
            |..:.||||||||.|......:.:||..|||   |.|  :.||...     .:||||||||| .:
plant   214 SLGVMHRDLKPENFLLVNKDDDFSLKAIDFGLSVFFKPGQIFTDVV-----GSPYYVAPEVL-LK 272

  Fly   195 KYDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIK 259
            :|....|:|:.||::||::.|.|||::.    ...|:.:.:..|..||....|..:|.:|||||:
plant   273 RYGPEADVWTAGVILYILLSGVPPFWAE----TQQGIFDAVLKGYIDFESDPWPVISDSAKDLIR 333

  Fly   260 GMLNVDPSKRLRIQDVISNKWIAQYNAVPQTPL------------CTGRMLKEAEETWPE-VQEE 311
            .||:..|::||...:|:.:.||.:....|...|            ...::.|.|.:...| :.||
plant   334 RMLSSKPAERLTAHEVLRHPWICENGVAPDRALDPAVLSRLKQFSAMNKLKKMALKVIAESLSEE 398

  Fly   312 MTRSLATMRVDYDQMQIKALDKSNNPLLT 340
            ....|..|        .:|:|..|:..:|
plant   399 EIAGLREM--------FQAMDTDNSGAIT 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 97/274 (35%)
S_TKc 25..281 CDD:214567 95/268 (35%)
CPK5NP_001329080.1 STKc_CAMK 97..354 CDD:270687 96/272 (35%)
PTZ00184 391..533 CDD:185504 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.