DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CDPK6

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_194096.1 Gene:CDPK6 / 828465 AraportID:AT4G23650 Length:529 Species:Arabidopsis thaliana


Alignment Length:360 Identity:124/360 - (34%)
Similarity:170/360 - (47%) Gaps:57/360 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGYGINGKVVQCTHRRTQQNYALKVLL--------DSERARREVDLHWRVSGCRYIVNIIDVYEN 82
            ||.|..|.....||:.|:|..|.|.:.        |.|..||||.:...:||.|.||::...|| 
plant    84 LGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDDIEDVRREVQIMHHLSGHRNIVDLKGAYE- 147

  Fly    83 TFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPEN 147
               ||..:.::||..||||||.||..|  |.::||.||.:..::...|...||..:.||||||||
plant   148 ---DRHSVNLIMELCEGGELFDRIISK--GLYSERAAADLCRQMVMVVHSCHSMGVMHRDLKPEN 207

  Fly   148 LLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVL----GPEKYDKSCDIWSLGVV 208
            .|:.:...|:.||.||||.:.........:....:.||||||||    |||     .||||.||:
plant   208 FLFLSKDENSPLKATDFGLSVFFKPGDKFKDLVGSAYYVAPEVLKRNYGPE-----ADIWSAGVI 267

  Fly   209 MYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRIQ 273
            :||::.|.|||:..:    ..|:.:.|..||.||....|..:|..||||::.||..||..||...
plant   268 LYILLSGVPPFWGEN----ETGIFDAILQGQLDFSADPWPALSDGAKDLVRKMLKYDPKDRLTAA 328

  Fly   274 DVISNKWIAQYNAVPQTPL------------CTGRMLKEAEETWPE-VQEEMTRSLATMRVDYDQ 325
            :|:::.||.:.......||            ...::.|.|.:...| :.||....|..|      
plant   329 EVLNHPWIREDGEASDKPLDNAVLSRMKQFRAMNKLKKMALKVIAENLSEEEIIGLKEM------ 387

  Fly   326 MQIKALDKSNNPLLT---------KRRKKIEEMEL 351
              .|:||..||.::|         |...||.|.|:
plant   388 --FKSLDTDNNGIVTLEELRTGLPKLGSKISEAEI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 102/265 (38%)
S_TKc 25..281 CDD:214567 102/266 (38%)
CDPK6NP_194096.1 STKc_CAMK 78..335 CDD:270687 102/265 (38%)
PTZ00184 372..515 CDD:185504 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.