DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK15

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001190794.1 Gene:CPK15 / 828283 AraportID:AT4G21940 Length:561 Species:Arabidopsis thaliana


Alignment Length:352 Identity:118/352 - (33%)
Similarity:167/352 - (47%) Gaps:42/352 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGYGINGKVVQCTHRRTQQNYALKVLL--------DSERARREVDLHWRVSGCRYIVNIIDVYEN 82
            ||.|..|....|....|...||.|.:|        |.:..:||:.:...:||...||.|...|| 
plant   108 LGRGQFGITYTCKENSTGNTYACKSILKRKLTRKQDIDDVKREIQIMQYLSGQENIVEIKGAYE- 171

  Fly    83 TFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPEN 147
               ||:.:.:|||...|.|||.||  .|.|.::|:.||.::..:...|...|...:.||||||||
plant   172 ---DRQSIHLVMELCGGSELFDRI--IAQGHYSEKAAAGVIRSVLNVVQICHFMGVIHRDLKPEN 231

  Fly   148 LLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVVMYII 212
            .|..:|..||.||.||||.:.........:....:.|||||||| ...|.|..||||.|:::||:
plant   232 FLLASTDENAMLKATDFGLSVFIEEGKVYRDIVGSAYYVAPEVL-RRSYGKEIDIWSAGIILYIL 295

  Fly   213 MCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRIQDVIS 277
            :||.|||:|.    ...|:.|.|..|:.||....|.::|::||||::.:|..||.:|:.....:.
plant   296 LCGVPPFWSE----TEKGIFNEIIKGEIDFDSQPWPSISESAKDLVRKLLTKDPKQRISAAQALE 356

  Fly   278 NKWIAQYNAVPQTPL---CTGRM-------------LKEAEETWPEVQEEMTRSLATM--RVDYD 324
            :.||....| |..|:   ...||             ||...|:   :.||..:.|.||  .:|.|
plant   357 HPWIRGGEA-PDKPIDSAVLSRMKQFRAMNKLKKLALKVIAES---LSEEEIKGLKTMFANMDTD 417

  Fly   325 QMQIKALDKSNNPLLTKRRKKIEEMEL 351
            :......::..|. |.|...|:.|.|:
plant   418 KSGTITYEELKNG-LAKLGSKLTEAEV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 95/261 (36%)
S_TKc 25..281 CDD:214567 95/262 (36%)
CPK15NP_001190794.1 S_TKc 102..360 CDD:214567 95/262 (36%)
STKc_CAMK 102..359 CDD:270687 95/261 (36%)
PTZ00184 395..540 CDD:185504 14/53 (26%)
EFh 407..466 CDD:238008 11/38 (29%)
EFh 478..539 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.