DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK4

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_192695.1 Gene:CPK4 / 826541 AraportID:AT4G09570 Length:501 Species:Arabidopsis thaliana


Alignment Length:368 Identity:119/368 - (32%)
Similarity:178/368 - (48%) Gaps:43/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NQRQPKT------TPLTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVL--------LDSER 56
            |.|:|..      ||...|:......||.|..|....||.:.:..|||.|.:        .|.|.
plant     5 NPRRPSNSVLPYETPRLRDHYLLGKKLGQGQFGTTYLCTEKSSSANYACKSIPKRKLVCREDYED 69

  Fly    57 ARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQ 121
            ..||:.:...:|....:|.|    :.|::|...:.:|||..||||||.||..|  |.|:|||||:
plant    70 VWREIQIMHHLSEHPNVVRI----KGTYEDSVFVHIVMEVCEGGELFDRIVSK--GCFSEREAAK 128

  Fly   122 IMHEICAAVDYLHSRDIAHRDLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYV 186
            ::..|...|:..||..:.||||||||.|:.:...:|.||.||||.:........|.....:||||
plant   129 LIKTILGVVEACHSLGVMHRDLKPENFLFDSPSDDAKLKATDFGLSVFYKPGQYLYDVVGSPYYV 193

  Fly   187 APEVL----GPEKYDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEW 247
            |||||    |||     .|:||.||::||::.|.|||::.    ...|:..:|..|:.||....|
plant   194 APEVLKKCYGPE-----IDVWSAGVILYILLSGVPPFWAE----TESGIFRQILQGKIDFKSDPW 249

  Fly   248 TNVSQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQYNAVPQTPLCTGRMLKEAEETWPEVQEEM 312
            ..:|:.|||||..||:..|.||:...:.:.:.||...:|.|..||....:.:..:.:.....::|
plant   250 PTISEGAKDLIYKMLDRSPKKRISAHEALCHPWIVDEHAAPDKPLDPAVLSRLKQFSQMNKIKKM 314

  Fly   313 TRSLATMRVDYDQM-----QIKALDKSNNPLLTKRRKKIEEME 350
            ...:...|:..:::     ..|.:|..|:..:|     .||::
plant   315 ALRVIAERLSEEEIGGLKELFKMIDTDNSGTIT-----FEELK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 100/273 (37%)
S_TKc 25..281 CDD:214567 99/267 (37%)
CPK4NP_192695.1 STKc_CAMK 24..282 CDD:270687 99/272 (36%)
PTZ00184 319..461 CDD:185504 7/39 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.