DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK22

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001329212.1 Gene:CPK22 / 825806 AraportID:AT4G04710 Length:500 Species:Arabidopsis thaliana


Alignment Length:386 Identity:119/386 - (30%)
Similarity:178/386 - (46%) Gaps:48/386 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSLQNQRQPKTTPLTD--DYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVL----LDSER--- 56
            ::|.|.|......||.|  .:.:....||.|..|....|....|.::||.|.:    |.||.   
plant    15 IVSDQKQETILGKPLEDIKKHYSFGDELGKGNFGTTYLCKENSTGKSYACKSIPKRTLSSEEEKE 79

  Fly    57 -ARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQD--KADGAFTERE 118
             .:.|:.:...|||...||.|    :.:::|...:.:|||...|||||.:|..  |:...::|::
plant    80 AVKTEIQIMDHVSGQPNIVQI----KGSYEDNNSIHIVMELCGGGELFDKIDALVKSHSYYSEKD 140

  Fly   119 AAQIMHEICAAVDYLHSRDIAHRDLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTP 183
            ||.|...|..||...||.|:.||||||||.|:::...||.||..|||.:.......|.:....:.
plant   141 AAGIFRSIVNAVKICHSLDVVHRDLKPENFLFSSKDENAMLKAIDFGCSVYIKEGKTFERVVGSK 205

  Fly   184 YYVAPEVLGPEKYDKSCDIWSLGVVMYIIMCGFPPFYSN-HGLAISP--GMKNRIRTGQYDFPDP 245
            ||:||||| ...|.|..||||.||::||::.|.|||.:. ..:.:|.  .:...|:..:.||...
plant   206 YYIAPEVL-EGSYGKEIDIWSAGVILYILLSGVPPFQTGIESIIVSTLCIVDAEIKECRLDFESQ 269

  Fly   246 EWTNVSQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQYNAVPQTPL------------CTGRML 298
            .|..:|..||.||..||...|.:|:...||:.:.|:.  :..|..|:            ...::.
plant   270 PWPLISFKAKHLIGKMLTKKPKERISAADVLEHPWMK--SEAPDKPIDNVVLSRMKQFRAMNKLK 332

  Fly   299 KEAEETWPE-VQEEMTRSLATMRVDYDQMQIKALDKSNNPL-------LTKRRKKIEEMEL 351
            |.|.:...| :.||..:.|.||..:.|      :|||.:..       |.:...|:.|.|:
plant   333 KLALKVIAEGLSEEEIKGLKTMFENMD------MDKSGSITYEELKMGLNRHGSKLSETEV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 94/274 (34%)
S_TKc 25..281 CDD:214567 94/268 (35%)
CPK22NP_001329212.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.