DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK27

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_192379.2 Gene:CPK27 / 825805 AraportID:AT4G04700 Length:485 Species:Arabidopsis thaliana


Alignment Length:361 Identity:105/361 - (29%)
Similarity:173/361 - (47%) Gaps:49/361 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNQRQPKTTPLTDDYVTSNTVLG-------YGINGKVVQCTHRRTQQNYALKVLLDS-------- 54
            |::|.....||.|  :|...:||       :|:..|   |..:.|.:.:|.|.:|.:        
plant    11 QSKRTILEKPLVD--ITKIYILGEELGRGNFGLTRK---CVEKSTGKTFACKTILKTKLKDEECE 70

  Fly    55 ERARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKAD--GAFTER 117
            |..:||:.:..::||   ..||:: ::|.::|:..:.:|||...||||:.:|....|  .:::|:
plant    71 EDVKREIRIMKQLSG---EPNIVE-FKNAYEDKDSVHIVMEYCGGGELYDKILALYDVGKSYSEK 131

  Fly   118 EAAQIMHEICAAVDYLHSRDIAHRDLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYT 182
            |||.|:..|...|...|...:.||||||||.|.|:...|||:|:.|||.:.........|....:
plant   132 EAAGIIRSIVNVVKNCHYMGVMHRDLKPENFLLTSNDDNATVKVIDFGCSVFIEEGKVYQDLAGS 196

  Fly   183 PYYVAPEVLGPEKYDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEW 247
            .||:||||| ...|.|..||||.|:::||::||..||....    ...|.|.|::.:.|:.:..|
plant   197 DYYIAPEVL-QGNYGKEADIWSAGIILYILLCGKSPFVKEP----EGQMFNEIKSLEIDYSEEPW 256

  Fly   248 TNVSQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQYNA----VPQTPLCTGRMLKEAEE----- 303
            ......|..|:|.||:.:|.:|:...:|:.:.|:.:..|    :....|...:..::|.:     
plant   257 PLRDSRAIHLVKRMLDRNPKERISAAEVLGHPWMKEGEASDKPIDGVVLSRLKRFRDANKFKKVV 321

  Fly   304 ---TWPEVQEEMTRSLATMRVDYDQMQIKALDKSNN 336
               ....:.||..:.|.|:..:.|      .|||.|
plant   322 LKFIAANLSEEEIKGLKTLFTNID------TDKSGN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 87/278 (31%)
S_TKc 25..281 CDD:214567 86/272 (32%)
CPK27NP_192379.2 S_TKc 28..290 CDD:214567 86/273 (32%)
STKc_CAMK 28..289 CDD:270687 86/272 (32%)
PTZ00184 325..468 CDD:185504 9/33 (27%)
EFh 337..396 CDD:238008 7/21 (33%)
EFh 411..469 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.