DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CRK

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001190048.1 Gene:CRK / 824217 AraportID:AT3G50530 Length:632 Species:Arabidopsis thaliana


Alignment Length:353 Identity:110/353 - (31%)
Similarity:160/353 - (45%) Gaps:57/353 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QNYALKVL--------LDSERARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGG 100
            |..|:||:        :..|..||||.:...:||...:.:..|.||    |...:.:|||..|||
plant   175 QQVAVKVIPKAKMTTAIAIEDVRREVKILRALSGHNNLPHFYDAYE----DHDNVYIVMELCEGG 235

  Fly   101 ELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPENLLYTTTQPNATLKLTDFG 165
            ||..||..:. |.:||.:|..:|.:|...|.:.|.:.:.||||||||.|:|:.:..:.||..|||
plant   236 ELLDRILSRG-GKYTEEDAKTVMIQILNVVAFCHLQGVVHRDLKPENFLFTSKEDTSQLKAIDFG 299

  Fly   166 FAK---------------------ET----------FTSYTLQTPCYTPYYVAPEVLGPEKYDKS 199
            .:.                     ||          |....|.....:.|||||||| ...|...
plant   300 LSDYVRPGKALRLYAICKLRFQNLETSICLYALTIAFADERLNDIVGSAYYVAPEVL-HRSYSTE 363

  Fly   200 CDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNV 264
            .||||:||::||::||..||::.    ...|:...:......|.||.|..:|..|:|.:|.:||.
plant   364 ADIWSVGVIVYILLCGSRPFWAR----TESGIFRAVLKADPSFDDPPWPLLSSEARDFVKRLLNK 424

  Fly   265 DPSKRLRIQDVISNKWIAQYN--AVPQTPLCTGRMLKEAEETWPEVQEEMTRSLA-TMRVD---Y 323
            ||.|||.....:|:.||...|  .||...|..  .|..|......:::...|:|: |:.||   |
plant   425 DPRKRLTAAQALSHPWIKDSNDAKVPMDILVF--KLMRAYLRSSSLRKAALRALSKTLTVDELFY 487

  Fly   324 DQMQIKALDKSNNPLLTKRRKKIEEMEL 351
            .:.|...|:.|.|..::....|...|::
plant   488 LREQFALLEPSKNGTISLENIKSALMKM 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 90/274 (33%)
S_TKc 25..281 CDD:214567 90/275 (33%)
CRKNP_001190048.1 STKc_CAMK 147..440 CDD:270687 90/274 (33%)
S_TKc 148..441 CDD:214567 90/275 (33%)
Glo_EDI_BRP_like 526..>597 CDD:301325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.