DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and AT3G49370

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_190506.1 Gene:AT3G49370 / 824099 AraportID:AT3G49370 Length:594 Species:Arabidopsis thaliana


Alignment Length:364 Identity:107/364 - (29%)
Similarity:162/364 - (44%) Gaps:85/364 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QNYALKVL--------LDSERARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGG 100
            |..|:|::        |..|..||||.|...:||..::|...||:|    |...:.||||..|||
plant   169 QTVAVKIISKSKMTSALSIEDVRREVKLLKALSGHSHMVKFYDVFE----DSDNVFVVMELCEGG 229

  Fly   101 ELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPENLLYTTTQPNATLKLTDFG 165
            ||...|..:. |.:.|.||.:|:.:|.:|..:.|.:.:.||||||||.|:|:...:|.||:.|||
plant   230 ELLDSILARG-GRYPEAEAKRILVQILSATAFFHLQGVVHRDLKPENFLFTSKNEDAVLKVIDFG 293

  Fly   166 FAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPG 230
            .:........|.....:.|||||||| ...|....||||:||:.||::||..|||.....||   
plant   294 LSDYARFDQRLNDVVGSAYYVAPEVL-HRSYSTEADIWSIGVISYILLCGSRPFYGRTESAI--- 354

  Fly   231 MKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQYN---------- 285
            .:..:|... :|.|..|.::|..|||.:|.:||.|..||:.....:::.|:...|          
plant   355 FRCVLRANP-NFDDLPWPSISPIAKDFVKRLLNKDHRKRMTAAQALAHPWLRDENPGLLLDFSIY 418

  Fly   286 ----------------------AVPQTPLCTGR---MLKEAEE---------------------- 303
                                  |:|:..|...:   ||.|.|:                      
plant   419 KLVKSYIRASPFRRAALKSLSKAIPEEELVFLKAQFMLLEPEDGGLHLHNFTTALTRYATDAMIE 483

  Fly   304 -TWPEVQEEMTRSLATMRVDYDQM--------QIKALDK 333
             ..|::. .|.:.||..::|:::.        |::||::
plant   484 SRLPDIL-NMMQPLAHKKLDFEEFCAASVSVYQLEALEE 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 90/243 (37%)
S_TKc 25..281 CDD:214567 90/244 (37%)
AT3G49370NP_190506.1 STKc_CAMK 141..403 CDD:270687 90/243 (37%)
S_TKc 142..404 CDD:214567 90/244 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.