DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and AT3G19100

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_188541.1 Gene:AT3G19100 / 821445 AraportID:AT3G19100 Length:599 Species:Arabidopsis thaliana


Alignment Length:334 Identity:102/334 - (30%)
Similarity:161/334 - (48%) Gaps:42/334 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QNYALKVL--------LDSERARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGG 100
            |..|:||:        :..|..||||.:...:||.:.:|...|.:|    |...:.:|||...||
plant   171 QEVAVKVIPKSKMTSAISIEDVRREVKILRALSGHQNLVQFYDAFE----DNANVYIVMELCGGG 231

  Fly   101 ELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPENLLYTTTQPNATLKLTDFG 165
            ||..||..:. |.::|.:|..::.:|...|.:.|.:.:.||||||||.|||:.:.|:.||:.|||
plant   232 ELLDRILARG-GKYSEDDAKAVLIQILNVVAFCHLQGVVHRDLKPENFLYTSKEENSMLKVIDFG 295

  Fly   166 FAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPG 230
            .:........|.....:.|||||||| ...|....|:||:||:.||::||..||::.    ...|
plant   296 LSDFVRPDERLNDIVGSAYYVAPEVL-HRSYTTEADVWSIGVIAYILLCGSRPFWAR----TESG 355

  Fly   231 MKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQYNAVP------- 288
            :...:......|.:|.|.::|..|||.:|.:|..||.||:.....:.:.|||.|..:.       
plant   356 IFRAVLKADPSFDEPPWPSLSFEAKDFVKRLLYKDPRKRMTASQALMHPWIAGYKKIDIPFDILI 420

  Fly   289 ----QTPLCTGRMLKEAEETWPEVQEEMTRSLATMRVDYDQMQIKALDKSNNPLLTKRRKKIEEM 349
                :..|.:..:.|.|       ...::::|.|..:.|.:.|...|..:.|.|:|     ::.:
plant   421 FKQIKAYLRSSSLRKAA-------LMALSKTLTTDELLYLKAQFAHLAPNKNGLIT-----LDSI 473

  Fly   350 ELYMA-NAT 357
            .|.:| |||
plant   474 RLALATNAT 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 82/243 (34%)
S_TKc 25..281 CDD:214567 82/244 (34%)
AT3G19100NP_188541.1 STKc_CAMK 145..405 CDD:270687 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.