DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK14

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_181717.3 Gene:CPK14 / 818786 AraportID:AT2G41860 Length:530 Species:Arabidopsis thaliana


Alignment Length:341 Identity:118/341 - (34%)
Similarity:165/341 - (48%) Gaps:35/341 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGYGINGKVVQCTHRRTQQNYA--------LKVLLDSERARREVDLHWRVSGCRYIVNIIDVYEN 82
            ||.|..|....||...|.:.:|        ||..:|.|..:|||::..::.....||.:.:.|| 
plant    60 LGRGEFGVTYLCTEIETGEIFACKSILKKKLKTSIDIEDVKREVEIMRQMPEHPNIVTLKETYE- 123

  Fly    83 TFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPEN 147
               |.|.:.:|||..||||||.||  .|.|.:|||.||.::..|...|...|...:.||||||||
plant   124 ---DDKAVHLVMELCEGGELFDRI--VARGHYTERAAASVIKTIIEVVQMCHKHGVMHRDLKPEN 183

  Fly   148 LLYTTTQPNATLKLTDFG---FAK--ETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGV 207
            .|:...:..|:||..|||   |.|  |.|....     .:|||:||||| ...|.:..||||.||
plant   184 FLFANKKETASLKAIDFGLSVFFKPGERFNEIV-----GSPYYMAPEVL-RRSYGQEIDIWSAGV 242

  Fly   208 VMYIIMCGFPPFY--SNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSKRL 270
            ::||::||.|||:  :.||:|      ..|.....||....|..||..||||||.||:.||.:||
plant   243 ILYILLCGVPPFWAETEHGVA------KAILKSVIDFKRDPWPKVSDNAKDLIKKMLHPDPRRRL 301

  Fly   271 RIQDVISNKWIAQYNAVPQTPLCTGRMLKEAEETWPEVQEEMTRSLATMRVDYDQMQIKALDKSN 335
            ..|.|:.:.||  .|....:.:..|..::...:.:..:.:...|:|..:.......:...:.:..
plant   302 TAQQVLDHPWI--QNGKNASNVSLGETVRARLKQFSVMNKLKKRALRVIAEHLSVEETSCIKERF 364

  Fly   336 NPLLTKRRKKIEEMEL 351
            ..:.|..|.||...||
plant   365 QVMDTSNRGKITITEL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 106/268 (40%)
S_TKc 25..281 CDD:214567 106/269 (39%)
CPK14NP_181717.3 STKc_CAMK 53..311 CDD:270687 106/268 (40%)
FRQ1 351..493 CDD:227455 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.