DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CRK1

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_181647.1 Gene:CRK1 / 818713 AraportID:AT2G41140 Length:576 Species:Arabidopsis thaliana


Alignment Length:273 Identity:85/273 - (31%)
Similarity:137/273 - (50%) Gaps:29/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YGINGKV------VQCTHRRTQ-----QNYALKVLLDS--------ERARREVDLHWRVSGCRYI 73
            |.|:|:|      ..|:.:..:     |..|:||:..|        |...|||.:...::|.:.:
plant   123 YEIDGEVGRGHFGYTCSAKGKKGSLKGQEVAVKVIPKSKMTTAIAIEDVSREVKMLRALTGHKNL 187

  Fly    74 VNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDI 138
            |...|.:|    |.:.:.:|||..:||||..:|..:. |.::|.:|.::|.:|.:.|.|.|.:.:
plant   188 VQFYDAFE----DDENVYIVMELCKGGELLDKILQRG-GKYSEDDAKKVMVQILSVVAYCHLQGV 247

  Fly   139 AHRDLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSCDIW 203
            .||||||||.|::|....:.||..|||.:........|.....:.|||||||| ...|....|:|
plant   248 VHRDLKPENFLFSTKDETSPLKAIDFGLSDYVKPDERLNDIVGSAYYVAPEVL-HRTYGTEADMW 311

  Fly   204 SLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPSK 268
            |:||:.||::||..||::.    ...|:...:...:.:|.:..|.::|..|.|.:|.:||.|..|
plant   312 SIGVIAYILLCGSRPFWAR----TESGIFRAVLKAEPNFEEAPWPSLSPEAVDFVKRLLNKDYRK 372

  Fly   269 RLRIQDVISNKWI 281
            ||.....:.:.|:
plant   373 RLTAAQALCHPWL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 84/270 (31%)
S_TKc 25..281 CDD:214567 84/271 (31%)
CRK1NP_181647.1 STKc_CAMK 122..384 CDD:270687 84/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.