DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK20

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_181425.1 Gene:CPK20 / 818476 AraportID:AT2G38910 Length:583 Species:Arabidopsis thaliana


Alignment Length:372 Identity:118/372 - (31%)
Similarity:177/372 - (47%) Gaps:68/372 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTTPLTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVLL--------DSERARREVDLHWRV 67
            ||..|.|.|..... ||.|..|....|..::|.:.:|.|.:.        |.|..|||:.:...:
plant   126 KTENLKDIYSVGRK-LGQGQFGTTFLCVDKKTGKEFACKTIAKRKLTTPEDVEDVRREIQIMHHL 189

  Fly    68 SGCRYIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDY 132
            ||...::.|:..||    |...:.||||...|||||.||..:  |.:||::||::...|...::.
plant   190 SGHPNVIQIVGAYE----DAVAVHVVMEICAGGELFDRIIQR--GHYTEKKAAELARIIVGVIEA 248

  Fly   133 LHSRDIAHRDLKPENLLYTTTQPNATLKLTDFG---FAK--ETFTSYTLQTPCYTPYYVAPEVLG 192
            .||..:.||||||||.|:.:....|.||..|||   |.|  ||||...     .:||||||||| 
plant   249 CHSLGVMHRDLKPENFLFVSGDEEAALKTIDFGLSVFFKPGETFTDVV-----GSPYYVAPEVL- 307

  Fly   193 PEKYDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDL 257
            .:.|...||:||.||::||::.|.|||:..    ...|:..::..|..||....|.:||::||||
plant   308 RKHYSHECDVWSAGVIIYILLSGVPPFWDE----TEQGIFEQVLKGDLDFISEPWPSVSESAKDL 368

  Fly   258 IKGMLNVDPSKRLRIQDVISNKW-------------------IAQYNAVPQTPLCTGRMLKEAEE 303
            ::.||..||.||:...:|:.:.|                   :.|::|:.:......:::.|:  
plant   369 VRRMLIRDPKKRMTTHEVLCHPWARVDGVALDKPLDSAVLSRLQQFSAMNKLKKIAIKVIAES-- 431

  Fly   304 TWPEVQEEMTRSLATMRVDYDQMQIKALDKSNNPLLTKRRKKIEEME 350
                :.||....|..|        .|.:|..|:..:|     :||::
plant   432 ----LSEEEIAGLKEM--------FKMIDTDNSGHIT-----LEELK 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 100/274 (36%)
S_TKc 25..281 CDD:214567 100/287 (35%)
CPK20NP_181425.1 STKc_CAMK 134..391 CDD:270687 100/273 (37%)
FRQ1 432..572 CDD:227455 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.