DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK24

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_180708.1 Gene:CPK24 / 817708 AraportID:AT2G31500 Length:582 Species:Arabidopsis thaliana


Alignment Length:285 Identity:100/285 - (35%)
Similarity:142/285 - (49%) Gaps:39/285 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGYGINGKVVQCTHRRTQQNYA--------LKVLLDSERARREVDL------HWRVSGCRYIVNI 76
            ||.|..|...:|....|::.:|        |:..:|.|..||||::      |         .||
plant    72 LGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVEDVRREVEIMRCLPKH---------PNI 127

  Fly    77 IDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHR 141
            :. ::..|:|:..:.:|||..||||||.||..:  |.:|||.||.:...|...|...|...:.||
plant   128 VS-FKEAFEDKDAVYLVMEICEGGELFDRIVSR--GHYTERAAASVAKTILEVVKVCHEHGVIHR 189

  Fly   142 DLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVL----GPEKYDKSCDI 202
            ||||||.|::.....|.||..|||.:.....:........:|||:|||||    |||     .|:
plant   190 DLKPENFLFSNGTETAQLKAIDFGLSIFFKPAQRFNEIVGSPYYMAPEVLRRNYGPE-----IDV 249

  Fly   203 WSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDPS 267
            ||.||::||::||.|||::.    ...|:.:.|..|..||....|..||..||:|:|.||:.:|.
plant   250 WSAGVILYILLCGVPPFWAE----TEEGIAHAIVRGNIDFERDPWPKVSHEAKELVKNMLDANPY 310

  Fly   268 KRLRIQDVISNKWIAQYNAVPQTPL 292
            .||.:|:|:.:.||......|...|
plant   311 SRLTVQEVLEHPWIRNAERAPNVNL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 96/271 (35%)
S_TKc 25..281 CDD:214567 96/272 (35%)
CPK24NP_180708.1 STKc_CAMK 65..323 CDD:270687 96/271 (35%)
FRQ1 363..512 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.