DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPk-Ak2 and CPK6

DIOPT Version :9

Sequence 1:NP_001188547.1 Gene:MAPk-Ak2 / 44573 FlyBaseID:FBgn0013987 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001324056.1 Gene:CPK6 / 816235 AraportID:AT2G17290 Length:544 Species:Arabidopsis thaliana


Alignment Length:353 Identity:114/353 - (32%)
Similarity:164/353 - (46%) Gaps:48/353 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TPLTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKVLL--------DSERARREVDLHWRVSG 69
            ||...|..|.:..||.|..|....||...|..:||.|.:.        |.|..|||:.:...::|
plant    78 TPNIRDLYTLSRKLGQGQFGTTYLCTDIATGVDYACKSISKRKLISKEDVEDVRREIQIMHHLAG 142

  Fly    70 CRYIVNIIDVYENTFKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYLH 134
            .:.||.|...||    |...:.:|||...|||||.||..:  |.::||:||::...|...|:..|
plant   143 HKNIVTIKGAYE----DPLYVHIVMELCAGGELFDRIIHR--GHYSERKAAELTKIIVGVVEACH 201

  Fly   135 SRDIAHRDLKPENLLYTTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVL----GPEK 195
            |..:.||||||||.|......:.:||..|||.:.........:....:|||||||||    ||| 
plant   202 SLGVMHRDLKPENFLLVNKDDDFSLKAIDFGLSVFFKPGQIFKDVVGSPYYVAPEVLLKHYGPE- 265

  Fly   196 YDKSCDIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKG 260
                .|:|:.||::||::.|.|||::.    ...|:.:.:..|..||....|..:|.:|||||:.
plant   266 ----ADVWTAGVILYILLSGVPPFWAE----TQQGIFDAVLKGYIDFDTDPWPVISDSAKDLIRK 322

  Fly   261 MLNVDPSKRLRIQDVISNKWIAQYNAVPQTPL------------CTGRMLKEAEETWPE-VQEEM 312
            ||...||:||...:|:.:.||.:....|...|            ...::.|.|.:...| :.||.
plant   323 MLCSSPSERLTAHEVLRHPWICENGVAPDRALDPAVLSRLKQFSAMNKLKKMALKVIAESLSEEE 387

  Fly   313 TRSLATMRVDYDQMQIKALDKSNNPLLT 340
            ...|..|        .:|:|..|:..:|
plant   388 IAGLRAM--------FEAMDTDNSGAIT 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPk-Ak2NP_001188547.1 STKc_MAPKAPK 18..280 CDD:270991 97/273 (36%)
S_TKc 25..281 CDD:214567 95/267 (36%)
CPK6NP_001324056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.