DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd3 and Zmynd15

DIOPT Version :9

Sequence 1:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001025100.1 Gene:Zmynd15 / 574428 MGIID:3603821 Length:736 Species:Mus musculus


Alignment Length:97 Identity:24/97 - (24%)
Similarity:36/97 - (37%) Gaps:18/97 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KNLKNPAPQI-----KRGQRILTEKP-FAFVLKSQYRLERCDNCLE---ATKVLKCSNCRYVSYC 81
            :.|::..|::     |...|....:| |.|   :..|...|..|.:   ..|:..|..|..|.||
Mouse   270 RELESLVPRLGVKLAKTPMRTWGPRPGFTF---ASLRARTCHVCHKHSFEVKLTPCPQCSAVLYC 331

  Fly    82 HRSCQMQAWGQ------HKHECPFLKKVHPRV 107
            ..:|....|.:      |:..||.|.....||
Mouse   332 GEACLQADWRRCPDDVSHRFWCPRLSAFMERV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 11/45 (24%)
TPR_12 377..440 CDD:290160
Zmynd15NP_001025100.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..192
zf-MYND 307..353 CDD:280009 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 696..736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.