DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd3 and CG18213

DIOPT Version :9

Sequence 1:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_650589.2 Gene:CG18213 / 42055 FlyBaseID:FBgn0038470 Length:879 Species:Drosophila melanogaster


Alignment Length:626 Identity:117/626 - (18%)
Similarity:200/626 - (31%) Gaps:242/626 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ASACSSKSKNLKN-----PAPQIKRGQRILTEKPFAFVLKSQYRLERCDNC-LEATKVLKCSNCR 76
            :.||....|:::.     .:..:.:|:.:|.|.|..|...:.:.  .|:.| :...::..|.|||
  Fly   226 SQACDYSEKSIEKSGGVFASCDVPKGEIVLVENPVYFQFSAPFL--NCELCGVHQQQLYTCDNCR 288

  Fly    77 YVSYCHRSCQMQAWGQHKHEC--------PFLKKVHPRVVPDAARMLCRLILR------------ 121
            |.|||.:||.......|::||        |.|:          |.||.||...            
  Fly   289 YRSYCSKSCMKSDAEVHQYECYGYKIGLIPMLE----------ANMLFRLFCEAGEYILPAIVDY 343

  Fly   122 -----------------LEHG----------GDLI----------RGYYTEHGSRKFRDLMSHYA 149
                             |||.          |:|:          |..|||..:..||  :|.: 
  Fly   344 AMDGGILSNPRDAWTFILEHAQEEEKTYNLVGELLATAPDYNLLTREKYTEIVTTAFR--LSVF- 405

  Fly   150 EIKNDPMRLE-HLDSLHAVLTDMMAESPSTVPNKTELMSIYGRLITN------------------ 195
             |.||....| :...|..|.||::....:.      |:.:.|.::.|                  
  Fly   406 -IYNDTRLAEKYFYLLALVKTDLITVMAAI------LLRLGGHVLLNSQRDNLCYRQREGIDAMN 463

  Fly   196 -------GFNILDAEMNSIATAI--YLGV-SITDH-SCQPN---AVATFE--------------- 231
                   ...||....:.|:..:  |.|| :|||. .|..|   ::|..|               
  Fly   464 ENNDEFENCGILPMPTDRISANVFSYYGVNAITDFVDCYNNVHDSLAEIEPEYPEKFSNDSPIFR 528

  Fly   232 -GNELH--------VHAIEDMECLDW--SKIFISYIDLLNTPEQRRL--DLKEHY------YF-- 275
             .:.||        :.|:||:...|.  .:.....:.:.||.::.:|  ::.:::      ||  
  Fly   529 FADRLHSICMQKYEIEAVEDLVSADTLPEQEINEILQIFNTSQRCQLLTNIAKYFQQFVYQYFHK 593

  Fly   276 ----------LCVCSKCTDAK-ESKEMLAALCPNRNCGAGISVDRNN-------CP--------- 313
                      |||..|..... .:|.:.|...||... .|::..:.:       ||         
  Fly   594 IENTVQLKSTLCVTLKAFKQNCGTKNIKAIFLPNGKV-VGVTAKKVHKGEELVICPDFARYRDQS 657

  Fly   314 -------RCDAGISPKLRNAFNEAMTLTRHNLENMKDVAYLDVCKVCLDKQTGVFHPLNVWYVKT 371
                   |.|...|..:.|.:        .|||.|....::...|..:   ..:...|:.|....
  Fly   658 RILDLARRGDFNFSTSIENEY--------ENLEKMPSPEFVRHNKAFI---AAIKKNLSAWIESR 711

  Fly   372 LDAAFEAAIEVGKWSDALDYGQRLLPGFRKYHGPWNPLLGLLHMK-------LGKIQL------- 422
            ||...:..:.:                   .:|.:|..|. ||.:       ||.::.       
  Fly   712 LDVNLQLNLTI-------------------LYGTYNSFLA-LHCEEKDETRFLGVLKFSMFLALN 756

  Fly   423 -YEGHSKEALHHLEEAQRILTVT---HGRDHRLLTEQLYML 459
             :..||.:.:.|..|    ||.|   |.::..:..:.|.::
  Fly   757 GFLQHSTDNIVHFVE----LTETDDIHFKNIEIYRQSLCVI 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 13/37 (35%)
TPR_12 377..440 CDD:290160 11/77 (14%)
CG18213NP_650589.2 zf-MYND 271..309 CDD:280009 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000637
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.