DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd3 and SmydA-1

DIOPT Version :9

Sequence 1:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster


Alignment Length:397 Identity:86/397 - (21%)
Similarity:125/397 - (31%) Gaps:145/397 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CDNCLEATKVLKCSNCRYVSYCHRSCQMQAWGQHKHECPFLKKVH-------------------- 104
            |..|.|.|| .|||||..||||....|.|.|..||..|...|..|                    
  Fly     4 CHVCEEPTK-NKCSNCNQVSYCSVQHQKQDWKVHKPSCHPFKIAHNEQLGRHLVATRTIKPYEIV 67

  Fly   105 --------------------------------------PRVVP-----DAARMLCRL-------I 119
                                                  |...|     |..:..|.|       :
  Fly    68 LKEAPLVRGPAQISAPVCLGCLNGIEAEDHIECEQCGWPLCGPECKSLDEHKAECGLTKDRGQKV 132

  Fly   120 LRLEHGGD------------LIRGYYTEHGSRKFRDLMSHYAEIKNDPMRLEHLDSLHAVLTDMM 172
            ...|.||.            |:.|..:...:.||:|              ||.|:|.........
  Fly   133 NVQEFGGPHPLYTCLSTVRCLLIGETSTEKASKFQD--------------LESLESTRRGSNQWK 183

  Fly   173 AESPST---VPN--KT------ELMSIYGRLITNGFNILDAEMNSIATAIYLGVSITDHSCQPNA 226
            |:..|.   :|.  ||      |:|...|.|..||..:...:.:.:  |::...|.|::||.||.
  Fly   184 ADLVSIGQFIPKFFKTQKFTEEEIMKAVGALQINGHEVPTTDPSHV--AVFYTASFTENSCLPNL 246

  Fly   227 VATFEGNELHVHAIEDMECLDW--------SKIFISYIDLLNTPEQRRLDLKEHYYFLCVCSKCT 283
            ..:|..|.         .|:.|        :.:.|.|.|.:.....|:..|.:...|.|.|.:|.
  Fly   247 AKSFNKNG---------HCILWAPREIKKNAHLSICYSDAMWGTADRQRHLMQTKLFKCACERCV 302

  Fly   284 DAKESKEMLAAL-CPNRNCGAGISV-----DRNNCPRCDAGISPKLRNAFNEAMTLTRHNLENMK 342
            |..|.....:|: |.:|.|| |:.:     :.|...||        |....:   :.:|.:|.:.
  Fly   303 DVTELDTNYSAIKCEDRQCG-GLMLPTKADEWNGSWRC--------RECHKQ---VQKHYVERIL 355

  Fly   343 DVAYLDV 349
            :.|..|:
  Fly   356 ERAGKDI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 19/36 (53%)
TPR_12 377..440 CDD:290160
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009 19/36 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.