DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd3 and Smyd5

DIOPT Version :9

Sequence 1:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001101340.1 Gene:Smyd5 / 312503 RGDID:1309153 Length:417 Species:Rattus norvegicus


Alignment Length:401 Identity:97/401 - (24%)
Similarity:151/401 - (37%) Gaps:136/401 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GSSRSATTSATASACSSKSKNLKNPAPQ-IKRGQRILTEKPFA---FVLKSQYRLERCDNCLEAT 67
            |.:|.:......|  |:|.|.|.  |.| |::|:.|..|:|..   |:..:.||...||:||.|.
  Rat    17 GGARGSVEVRFVS--SAKGKGLF--ATQLIRKGETIFIERPLVASQFLWNALYRYRACDHCLRAL 77

  Fly    68 ---------------KVL--------------KCSNCRYVSYCHRSCQMQAWGQ-HKHECPFLKK 102
                           :||              .|..|: |:||...|::.|..| |:..||...:
  Rat    78 EKAEENAQRLTGKPGQVLPHPELCSVRKDLHQNCPRCQ-VTYCSAECRLAAAEQYHQILCPGPSQ 141

  Fly   103 VHPR--------------VVPDAA--RMLCRLILRLEHGGDLIRGYYTEHGSRKFRDLMSHY-AE 150
            ..||              ..|:.|  .::.|::..::...|      .:|..|    |.||: ::
  Rat   142 DDPRHPLNKLQEAWRSVHYPPETASIMLMARMVATVKQAKD------KDHWVR----LFSHFCSK 196

  Fly   151 IKNDPMRLEH----------LDSLHAVLTDMMAE---SPSTVPNKTELMSIYGRLITNGFNI--- 199
            ..|:...:.|          |:.|..:.|:.:.|   |....|:  ...|::..:.|||..|   
  Rat   197 TANEEEEIVHKLLGDKFKGQLELLRRLFTEALYEETLSQWFTPD--GFRSLFALVGTNGQGIGTS 259

  Fly   200 ---------------------LDAEMNSI------ATAIYLGV---------SITDHSCQPNAVA 228
                                 ||..::.:      ||..:|..         |..:|||.|||..
  Rat   260 SLSQWVHACDALELKPQEREQLDTFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAET 324

  Fly   229 TFEGNE--LHVHAIEDMECLDWSKIFISYIDLL---NTPEQRRLDLKEHYYFLCVCSKC------ 282
            :|..|.  |||.|:||:|  ...:|.|||:|..   .:...|...|:|:|.|:|.|.||      
  Rat   325 SFPENNFLLHVTALEDIE--PGEEICISYLDCCQRERSRHSRHKILRENYLFVCSCPKCLAEADD 387

  Fly   283 ---TDAKESKE 290
               |..:|.:|
  Rat   388 PNVTSEEEEEE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 16/66 (24%)
TPR_12 377..440 CDD:290160
Smyd5NP_001101340.1 DUF4599 68..144 CDD:292015 18/76 (24%)
SET <298..351 CDD:214614 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.