DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd3 and Zmynd15

DIOPT Version :9

Sequence 1:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001099270.1 Gene:Zmynd15 / 287457 RGDID:1309845 Length:738 Species:Rattus norvegicus


Alignment Length:152 Identity:30/152 - (19%)
Similarity:46/152 - (30%) Gaps:63/152 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KNLKNPAPQI-----KRGQRILTEKP-FAFVLKSQYRLERCDNCLE---ATKVLKCSNCRYVSYC 81
            :.|::..|::     |...|....:| |.|   :..|...|..|.:   ..|:..|..|..|.||
  Rat   272 RELESLVPRLGVKLAKTPMRTWGPRPGFTF---ASLRARTCHVCHKHSFEVKLTPCPQCSAVLYC 333

  Fly    82 HRSCQMQAWGQ------HKHECPFLKKVHPRVVPDAARMLCRLILRLEHGGD------------- 127
            ..:|....|.:      |:..||                  ||...:|..|:             
  Rat   334 GEACLQADWRRCPDDVSHRFWCP------------------RLAAFMERAGELASLPFTYTAEVT 380

  Fly   128 --------------LIRGYYTE 135
                          |.|||:|:
  Rat   381 SETFNKEAFLASRGLTRGYWTQ 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 11/45 (24%)
TPR_12 377..440 CDD:290160
Zmynd15NP_001099270.1 zf-MYND 309..355 CDD:280009 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342697
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.