DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd3 and set5

DIOPT Version :9

Sequence 1:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_588413.1 Gene:set5 / 2538853 PomBaseID:SPCC1739.05 Length:319 Species:Schizosaccharomyces pombe


Alignment Length:300 Identity:67/300 - (22%)
Similarity:113/300 - (37%) Gaps:75/300 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LIRGYYTEHGSRKFRDLMSHYAEIKNDPMRLEHLDSLHAVLTDMMAESPSTVPNKTELMSIYGRL 192
            |||   |:..:::..:.:|  .:.|.:......|.:.|   .|.|  .|...|       .|...
pombe    39 LIR---TKSDAKEIEEALS--TKTKEEQEAFHRLFNAH---PDTM--GPFLGP-------FYSNA 86

  Fly   193 IT-----NGFNILDAEMNSIATAIYLGVSITDHSCQPNAVATFEG--NELHVHAIEDMECLDWSK 250
            :|     .|..:|.:.||              |.|.||...|:..  :::.|||:.|:|.  ..:
pombe    87 LTIDETKGGMFLLGSRMN--------------HDCSPNVKHTWNPRLDQVTVHAVRDIEA--GEE 135

  Fly   251 IFISYIDLLNTPEQRRLDLKEHYYFLCVCSKCTDAKESKEMLAALCPNRNCGAGISVDRNNCPRC 315
            |..:||||..:..:|:..|.||:.|.|.||.|:..:.....::.|...:..    ..||.....|
pombe   136 ILTTYIDLHKSHTERQKILLEHFGFKCYCSVCSVEERKIRKISDLRRKQLA----YYDRTMAKMC 196

  Fly   316 DAGISPKLRNAFNEAMTLTRHNLE---------NMKDVAYLDVCKVCLDKQTGVFHPLNVWYVKT 371
            .  ::|:      .|:...||.:.         .:..:|.||..::|:..  |.|...:::..|.
pombe   197 I--VNPR------GALRALRHRIHIAHEELLFGRLDIIALLDAFRLCVIH--GDFERASIFAKKG 251

  Fly   372 LDAA-------FEAAIEVGKW-----SDALDYGQRLLPGF 399
            ..|.       .|..:::.|:     |.||..|...||.|
pombe   252 TKAISLYEGTDSEKYLKISKYVENPRSHALAEGVPALPLF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009
TPR_12 377..440 CDD:290160 8/27 (30%)
set5NP_588413.1 SET <1..319 CDD:225491 66/299 (22%)
SET 4..147 CDD:214614 33/140 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2289
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.