DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd3 and Smyd5

DIOPT Version :9

Sequence 1:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_659167.2 Gene:Smyd5 / 232187 MGIID:108048 Length:416 Species:Mus musculus


Alignment Length:384 Identity:89/384 - (23%)
Similarity:140/384 - (36%) Gaps:131/384 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSKSKNLKNPAPQ-IKRGQRILTEKPFA---FVLKSQYRLERCDNCLEA---------------T 67
            |.|.|.|.  |.| |::|:.|..|:|..   |:..:.|:...||:||.|               :
Mouse    30 SIKGKGLF--ATQLIRKGETIFIERPLVAAQFLWNALYQYRACDHCLRALEKAEENAQRLTGKPS 92

  Fly    68 KVL--------------KCSNCRYVSYCHRSCQMQAWGQ-HKHECP---------------FLKK 102
            ::|              .|.:|: |.||...|::.|..| |:..||               ..:.
Mouse    93 QILPHPELCSVRKDLHQNCPHCQ-VMYCSAECRLAAAEQYHQILCPGPSHDPRHPLNKLQEAWRS 156

  Fly   103 VHPRVVPDAA--RMLCRLILRLEHGGDLIRGYYTEHGSRKFRDLMSHYAEIKNDPMRLEH----- 160
            ||  ..|:.|  .::.|::..::...|      .:|..|.|....|..|   |....:.|     
Mouse   157 VH--YPPETASIMLMARMVATVKQAKD------KDHWVRLFNHFCSRTA---NQEQAIVHKLLKG 210

  Fly   161 -----LDSLHAVLTDMMAESPSTVPNKTE-LMSIYGRLITNGFNI-------------------- 199
                 |:.|..:..:.:.|...::....| ..|::..:.|||..|                    
Mouse   211 KFKDQLELLLGLFKEALYEEALSLWFTPEGFRSLFALVGTNGQGIGTSSLSQWVHACDALELTPQ 275

  Fly   200 ----LDAEMNSI------ATAIYLGV---------SITDHSCQPNAVATFEGNE--LHVHAIEDM 243
                ||..::.:      ||..:|..         |..:|||.|||..:|..|.  |||.|:||:
Mouse   276 DREQLDTFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFVLHVTALEDI 340

  Fly   244 ECLDWSKIFISYIDLL---NTPEQRRLDLKEHYYFLCVCSKC---------TDAKESKE 290
            :  ...:|.|||:|..   .:...|...|:|:|.|.|.|.||         |..:|.:|
Mouse   341 K--PGEEICISYLDCCQRERSRHSRHKILRENYLFNCSCPKCLAEADDPNVTSEEEEEE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 15/66 (23%)
TPR_12 377..440 CDD:290160
Smyd5NP_659167.2 SET <297..350 CDD:214614 18/54 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..416 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.