DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lola and pre-lola-G

DIOPT Version :9

Sequence 1:NP_788308.3 Gene:lola / 44548 FlyBaseID:FBgn0283521 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001260870.2 Gene:pre-lola-G / 14462577 FlyBaseID:FBgn0264817 Length:436 Species:Drosophila melanogaster


Alignment Length:471 Identity:128/471 - (27%)
Similarity:163/471 - (34%) Gaps:173/471 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 TAAKLEENQAVAQQQGQAAVTVTGPAGQPTPTITELLNAAAASHSEPKPTLTTLTSTPIKLPSSE 567
            ||:|......|.:.|...|..|.|.|.          .|||:.|..||.||.|..|:.....:  
  Fly   101 TASKNLNADEVMRVQNATATRVVGAAA----------GAAASFHPRPKYTLKTAASSTEHTTA-- 153

  Fly   568 CELINIKKIIPATTTIATHHPHTSSTIIHPHHIIQHVSQEPHHQEHHQQHQTIHIEEVPQTSQQH 632
                     ||.:..:|     .|:..:.|                  :.|...|.|....:..|
  Fly   154 ---------IPTSVLVA-----NSAAALTP------------------KPQAAVIAEALMRNGLH 186

  Fly   633 HQQQHHHQLQTVQPTHTQVQSIITAHPGQTINLVGLRNVQLADSKPIASRIRYSRGKIIGPT--V 695
            :.||   ||:..:....|     |.|          |.::..:...||       |..|.||  :
  Fly   187 NFQQ---QLRAQEILRQQ-----TPH----------RRIKEENDVEIA-------GGDITPTKIL 226

  Fly   696 QNLQIVETHEPIQHQHHELSDGTKYEISEIDLNNPNASAAIISDLVKYAEIDDIELPDGTKIGIG 760
            :||...:....::|...|...|...|..|..               :|...|||.|         
  Fly   227 ENLLRKQQERDLRHSECENEPGYSTEDDEEG---------------RYHAFDDIHL--------- 267

  Fly   761 FAPSEITEHMQTSGGETHITTIEHEPQELQTVHQHEQTQQTHHIHAGQLQTHHIQTVVQSSSGQQ 825
                     |:.|||:                                         ..::||..
  Fly   268 ---------MEQSGGK-----------------------------------------FGNNSGMG 282

  Fly   826 QHDQQQHHQHHSIELQDDDGVETI--TPEELGMHDSSKSYTILTTRPMKEESEHDPSGMTYELSL 888
            ..:...|....|..|........:  |..:.|...|:.|.|             .|:|:..    
  Fly   283 MFNANAHGGSASSILDAHQAFRNLEFTLSDYGGSSSNGSTT-------------SPNGIGL---- 330

  Fly   889 SDSSLGPCDDPESRYVCRHCGKKYRWKSTLRRHENVECGGKEPCHPCPYCSYKAKQRGNLGVHVR 953
                     |.|..|.|||||||||||||||||||||||||||.|.||||.||:|||||||||||
  Fly   331 ---------DGEPVYECRHCGKKYRWKSTLRRHENVECGGKEPSHQCPYCPYKSKQRGNLGVHVR 386

  Fly   954 KHHPEKPQLESKRGRK 969
            |||.:.|||.|||..|
  Fly   387 KHHTDLPQLPSKRRSK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolaNP_788308.3 BTB 22..117 CDD:279045
BTB 33..117 CDD:197585
C2H2 Zn finger 905..925 CDD:275368 19/19 (100%)
C2H2 Zn finger 935..955 CDD:275368 17/19 (89%)
pre-lola-GNP_001260870.2 C2H2 Zn finger 338..358 CDD:275368 19/19 (100%)
zf-H2C2_5 366..389 CDD:290620 19/22 (86%)
C2H2 Zn finger 368..388 CDD:275368 17/19 (89%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.