DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-291

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001123077.1 Gene:nhr-291 / 6418820 WormBaseID:WBGene00045515 Length:291 Species:Caenorhabditis elegans


Alignment Length:231 Identity:62/231 - (26%)
Similarity:104/231 - (45%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GSGTNSSQQQL--------QQQQQQQSPTVCAICGDRATGKH-YGASSCDGCKGFFRRSVRKNHQ 203
            |:....:|:.|        |....:.:...|::||....|.| ||..:|..|..||||::...:.
 Worm    12 GTSMYKNQKHLCVIPLVFPQMSNSETTSDCCSVCGGAPNGGHRYGPMACLSCITFFRRAISSGNV 76

  Fly   204 YTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPD-PGNGLSVIS 267
            ..|:....|.::.:.:|.||.|||:||...||..:|:|: ||.|..|....||.| ..:.|..:.
 Worm    77 GDCKKQSACEINHESKNSCRSCRLQKCLNVGMNPKAIQH-RDPIGQRSPPKDDSDSQKSDLQFLL 140

  Fly   268 LVKAENESRQSKAGAAMEPNINEDLSNKQF--ASINDVCESMKQQLLTLVEWAKQIPAFNELQLD 330
            .::.:...|..|.|..::   |:....||:  |:.:|:..:|.......:.||....||..|...
 Worm   141 DLQKKQRIRNQKYGIQLK---NDRSVKKQYRPANADDIRLTMSLGFQNAISWANPFEAFKNLTDS 202

  Fly   331 DQVALLRAHAGEHLLLGLSRRSMHLKD--VLLLSNN 364
            ::.|::.......:|:..:.:|....|  |.||.||
 Worm   203 EKAAVMSEFGVAFVLIEQAFKSAKEADEGVWLLQNN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 27/75 (36%)
NR_LBD_HNF4_like 264..494 CDD:132729 23/105 (22%)
nhr-291NP_001123077.1 NR_DBD_HNF4A 42..117 CDD:143518 27/75 (36%)
HOLI 179..>277 CDD:214658 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.