DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and tll

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster


Alignment Length:429 Identity:110/429 - (25%)
Similarity:172/429 - (40%) Gaps:120/429 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 CAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARN--CVVDKDKRNQCRYCRLRKCFK 232
            |.:|.|.::|||||..:||||.|||:||:|::.||.|:..:.  |||||..|||||.|||||||:
  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98

  Fly   233 AGMKKEAVQNERD--RISCRRTSNDDPDPGNGLSVISLVKAE---NESR--------------QS 278
            .||.|:|||:||.  ..:.||......|...|...:..:.||   |.:.              ..
  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163

  Fly   279 KAG------AAMEPNINE----DLS----------------------------------NKQFAS 299
            :||      ||.:|..:.    |||                                  .....:
  Fly   164 RAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMA 228

  Fly   300 INDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHLKDVLLL--- 361
            ...:.|:..:.|...|.|.|.:.||.||.:.||:.||.....|..:|.:::..|.:....||   
  Fly   229 AEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVY 293

  Fly   362 -SNNC------VITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFF--- 416
             |.|.      ::||.                .....|::..:..:.||.||:.|::|:..|   
  Fly   294 ESENANREIMGMVTRE----------------VHAFQEVLNQLCHLNIDSTEYECLRAISLFRKS 342

  Fly   417 --------------------DPN------AKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRF 455
                                .||      ::||.|..::.::.:...:.|.:||.........||
  Fly   343 PPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRF 407

  Fly   456 GEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEM 494
            ..:|.::.::..::...||::.|.|..|...|..|:.:|
  Fly   408 QTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 45/76 (59%)
NR_LBD_HNF4_like 264..494 CDD:132729 59/329 (18%)
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 46/82 (56%)
NR_LBD 215..436 CDD:416257 45/236 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34630at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.