DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and Hr83

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster


Alignment Length:317 Identity:84/317 - (26%)
Similarity:129/317 - (40%) Gaps:96/317 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 TVCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTC-RFARNCVVDKDKRNQCRYCRLRKCF 231
            :.||:|||:::|||||.|.||||..||:||||:...|.| ....||||||.:||.|..||.::|.
  Fly     5 SACAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCL 69

  Fly   232 KAGMKKEAVQNER----DRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKA------GAAMEP 286
            ..||...|||.||    .:::..||......|...        |.:.:..|:|      ...:..
  Fly    70 AVGMNAAAVQEERGPRNQQVALYRTGRRQAPPSQA--------APSPTPHSQALHFQILAQILVT 126

  Fly   287 NINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAH------------ 339
            .:.:..:|:|||.: |.|:   |..:..|.|:             ::.:|||.            
  Fly   127 CLRQAKANEQFALL-DRCQ---QDAIFQVVWS-------------EIFVLRASHWSLDISAMIDG 174

  Fly   340 AGEHLLLGLSRRSMHLK-DVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGID 403
            .|:..|..|...:..|: |||.|:                          .::.|:...|::.| 
  Fly   175 CGDEQLKRLICEAHQLRADVLELN--------------------------FMESLILCRKELAI- 212

  Fly   404 DTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILL 460
            :.|:|.|          .|.:....:.||....|.. .:|:         |||::||
  Fly   213 NAEYAVI----------LGSHSKAALISLARYTLQQ-SNYL---------RFGQLLL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 42/79 (53%)
NR_LBD_HNF4_like 264..494 CDD:132729 39/216 (18%)
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 42/80 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.