DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-219

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001309650.1 Gene:nhr-219 / 3565145 WormBaseID:WBGene00020555 Length:408 Species:Caenorhabditis elegans


Alignment Length:236 Identity:56/236 - (23%)
Similarity:94/236 - (39%) Gaps:48/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 SMFSPNNNLSGSGSGTNSSQQQLQQQQQQQSPTVCAICGDRATGKHYGASSCDGCKGFFRR-SVR 199
            |:.||:.::|     |.||.:.:.::        |.:|...:.|.|:|..||..|..|||| .|.
 Worm     3 SLSSPSTSIS-----TTSSPKLISEK--------CLVCDQPSHGNHFGVDSCRACAAFFRRVFVT 54

  Fly   200 KNHQYTC-RFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISC------------RR 251
            ...||.| .....||.|...|.:||.||..:||:.||:.:.:|..||..||            .|
 Worm    55 HKQQYKCINELEQCVPDARGRWKCRKCRTDRCFELGMRPDNIQYNRDMFSCTGEFPKQVIYKSTR 119

  Fly   252 TSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEP------------NINEDLSNKQFASI---- 300
            .....|:........||:::. |:..|:......|            .:.|....:.:.:|    
 Worm   120 IIPSKPECITYFDFSSLLESV-ENILSETTPKCVPFQCQTPLQRLAFGLKEIRKTQLWDNIPVIN 183

  Fly   301 ----NDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLR 337
                .:..|:.|.|:.....|...:..:.:|..||::.:::
 Worm   184 CIGKEETFENWKVQIERTTTWLSYMDQYRDLNFDDKMTIVQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 29/76 (38%)
NR_LBD_HNF4_like 264..494 CDD:132729 14/94 (15%)
nhr-219NP_001309650.1 ZnF_C4 23..94 CDD:197701 28/78 (36%)
Hormone_recep 178..381 CDD:278530 8/47 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.