DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-241

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_507649.2 Gene:nhr-241 / 190558 WormBaseID:WBGene00013483 Length:331 Species:Caenorhabditis elegans


Alignment Length:353 Identity:88/353 - (24%)
Similarity:151/353 - (42%) Gaps:61/353 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SPTVCAICGDRATGKHYG-ASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRK 229
            |..:|.:||..|:|:.|| |::|..|..||||||.:...|||:....|.:....|..|||||::|
 Worm    17 SNLLCTVCGAPASGRRYGAAAACLACIVFFRRSVLRKIHYTCQALGRCEITVASRCVCRYCRMQK 81

  Fly   230 CFKAGMKKEAVQNERD---------RISCRRTSNDDPDPGNGLS-VISLVKAENESRQSKAGAAM 284
            |..|||...|:| .||         |:|.||  |.|..|...|: .:||.:.:..|...|   ..
 Worm    82 CLAAGMDPRAIQ-IRDLLGPRSLSSRLSSRR--NLDFSPILDLTDFLSLQRTQCSSGNQK---CF 140

  Fly   285 EPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQ-LDDQVALLRAHAGEHLLLGL 348
            :....|       |:.:|:..|:|..:.....||.:   ||..: ..::.::|...|...:|:..
 Worm   141 QQTSRE-------ATSSDINSSLKLAIEHANSWALK---FNFYENFTEKTSILSEFAIGFMLIDQ 195

  Fly   349 SRRSMHLKD--VLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIK 411
            :.::....:  ..||.|...:..       :.:...|:..:.|::.:....|::.|::.|...:|
 Worm   196 AFKTAEEAENGFWLLQNGTFLVE-------NEHKSYSKYVSEILNSIAVPFKNLKIEEFECVILK 253

  Fly   412 ALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQY--------ESRGRFGEILLILPVLQSI 468
            .|:|...|:                |.|..|....|:|        .|....|||:|:|..::.:
 Worm   254 ILLFLSANS----------------LQNHRDLAPHRKYCFKLLTEHRSPPEAGEIILLLSSIRCV 302

  Fly   469 TWQMIEQIQFAKIFGVAHIDSLLQEMLL 496
            ........:.:.||.|.:.|..::.:|:
 Worm   303 IKSFYNVTRISDIFNVENFDDDVKVVLV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 33/75 (44%)
NR_LBD_HNF4_like 264..494 CDD:132729 43/241 (18%)
nhr-241NP_507649.2 NR_DBD_HNF4A 21..96 CDD:143518 33/75 (44%)
HOLI 155..302 CDD:214658 32/172 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.