DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-239

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_497579.3 Gene:nhr-239 / 190264 WormBaseID:WBGene00021848 Length:262 Species:Caenorhabditis elegans


Alignment Length:92 Identity:49/92 - (53%)
Similarity:60/92 - (65%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 CAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARN--CVVDKDKRNQCRYCRLRKCFK 232
            |.||||::.|:|||..:||||..||:||||||..||| .|.|  |||||.:||.|..|||.||.:
 Worm    11 CEICGDKSYGRHYGVWACDGCSCFFKRSVRKNIIYTC-IAGNWKCVVDKGRRNWCPACRLAKCTR 74

  Fly   233 AGMKKEAVQNERD--RISC---RRTSN 254
            ..|.:.|||.||.  |:.|   :.|:|
 Worm    75 LKMNRLAVQTERGPRRLRCLQLKHTNN 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 44/76 (58%)
NR_LBD_HNF4_like 264..494 CDD:132729
nhr-239NP_497579.3 NR_DBD_PNR_like_2 11..92 CDD:143515 46/81 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.