DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-130

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_503216.1 Gene:nhr-130 / 187965 WormBaseID:WBGene00003720 Length:440 Species:Caenorhabditis elegans


Alignment Length:412 Identity:98/412 - (23%)
Similarity:154/412 - (37%) Gaps:100/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 CAICGDRATGKHYGASSCDGCKGFFRRS-VRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKA 233
            |.:|...|.|.|:||.||..|..||||: ......|.|:...||.:.::.|.:|:.|||.:|.:.
 Worm    37 CQVCALPAHGNHFGAISCRACAAFFRRACTGTKTTYKCKKQNNCDIWENGRYKCKKCRLDRCNEV 101

  Fly   234 GMKKEAVQNERDRISC----------RRTSNDDPDP-------GNGLSVISL---VKAENESR-- 276
            ||.....|.:||.||.          |||......|       |....:|.|   :.:.:|..  
 Worm   102 GMDPGRFQFDRDLISATEKYPNSKNFRRTFGMSRLPETIEHFLGRPHFIIFLERHIYSHSEKNFV 166

  Fly   277 -----QSKAGAAME-----PNINEDLSNKQFASINDVCE----SMKQQLLT-------LVEW--- 317
                 .:||...:|     |.|..:...|....:|.|.:    |...||:|       |..|   
 Worm   167 DLQHLIAKASKLLELGSEKPLIARNNLEKLALGLNLVRDQPAGSHDVQLVTKLGKDEALTFWETD 231

  Fly   318 ----AKQIPAFNELQL---DDQVALLRA--HAGEHL----LLGLSRRS--MHLKDVLLLSNN--- 364
                ||.:..|::.||   :.|:.||::  |....|    |...|||.  ...|.::|..|:   
 Worm   232 FLTVAKWLTYFDDFQLLPHNQQILLLKSVWHVWNRLEKLALTATSRRQNVCEQKQLMLTYNSVCN 296

  Fly   365 -------------------CVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACI 410
                               |.......|.:::..||           .:|.::...|:.|...| 
 Worm   297 PKTIELDYSWFTKYPKEQLCFFFDEMEDYMLTSALD-----------PLTSLEPTDIELTYMLC- 349

  Fly   411 KALVFFDPNAKGLNEPHRI-KSLRHQILNNLEDYISDRQYESR--GRFGEILLILPVLQSITWQM 472
             .|.|.....:...|...: :..:..:.:||.||..:.....|  ||..::|.|..::|...|:.
 Worm   350 -QLCFHYAGKRYGGEILEVTEKFQENLADNLHDYYVNELNMPRYCGRLNQMLKINNLIQQDIWEK 413

  Fly   473 IEQIQFAKIFGVAHIDSLLQEM 494
            ..:.:.||:|.:..|:....||
 Worm   414 RAKHELAKVFDIFCIEFSHPEM 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 27/75 (36%)
NR_LBD_HNF4_like 264..494 CDD:132729 60/298 (20%)
nhr-130NP_503216.1 ZnF_C4 36..105 CDD:197701 26/67 (39%)
Hormone_recep 210..416 CDD:278530 45/218 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.