DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-196

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_506900.2 Gene:nhr-196 / 187053 WormBaseID:WBGene00010600 Length:340 Species:Caenorhabditis elegans


Alignment Length:339 Identity:80/339 - (23%)
Similarity:123/339 - (36%) Gaps:91/339 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 ATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQ 241
            ||.::||..||..||.||.||.:.|..|.||....|..:.:...:||.||.|||.|.|||...::
 Worm     2 ATSRNYGVLSCFACKMFFYRSSKNNLIYKCRNINQCFQNYNSPIKCRACRFRKCQKVGMKLLTLK 66

  Fly   242 N-----ERD------RISCRRTSN----------DDP---DPGNGLSVISLVKAENESRQSKAGA 282
            .     :.|      .:..|.:||          :||   |..|..:.:.|:|...|.|......
 Worm    67 TSLPDLDNDLNILFADLEIRDSSNHSIFLNFYSMEDPSLVDVLNNANTMHLIKRTPEVRSDTQEW 131

  Fly   283 AMEPNINEDLSNKQFASINDVCESMKQQLLTL--------------VEWAKQIPAF--------- 324
            ::..:.::......|..||::..:.|..|.|.              |...:.|..|         
 Worm   132 SLMLSFSKISYFMSFTFINELSLADKLILFTANILRTGTMARAMKSVLEKRSILIFPNEENIFPV 196

  Fly   325 -------NELQLDDQVAL--------LRAHAGEHLLLGL---------SRRSMHLKDVLLLSN-- 363
                   |...|..|:||        ||....|:|||.:         .:.|.|.|::|....  
 Worm   197 EMNTMFENSDVLVHQIALRIVAKFAELRMDRREYLLLKMIDFCNSAISDKLSYHAKNILSFHQKV 261

  Fly   364 -NCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDV--GIDDTEFACIKALVFFDPNAKGLNE 425
             :..:.:||       ....||.......||::|...:  .:::..|:|:....|. ||.|    
 Worm   262 YSSALLQHC-------QFTNSRTAPTRFTELLSVFNTIHKTVNNMRFSCMMVQCFV-PNFK---- 314

  Fly   426 PHRIKSLRHQILNN 439
               .|.|..::..|
 Worm   315 ---FKKLMREVYFN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 28/72 (39%)
NR_LBD_HNF4_like 264..494 CDD:132729 44/228 (19%)
nhr-196NP_506900.2 ZnF_C4 2..63 CDD:197701 28/60 (47%)
HOLI 134..295 CDD:214658 31/167 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.