DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-282

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001370053.1 Gene:nhr-282 / 186200 WormBaseID:WBGene00010017 Length:253 Species:Caenorhabditis elegans


Alignment Length:153 Identity:27/153 - (17%)
Similarity:50/153 - (32%) Gaps:61/153 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 KQFASINDVCESMKQQLLTLVEWAKQI--PAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHLKD 357
            |.|..:...||:.:..||    ..||:  |..:.:.::|              ||:         
 Worm    97 KNFVKVASFCEAFRYYLL----GEKQLTFPDGSNILIED--------------LGI--------- 134

  Fly   358 VLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKG 422
                                      .:|.||...||....::.|.:.||..:..|:|..|..:.
 Worm   135 --------------------------ELGERIKFRLVAKCCELQITNEEFLLLLVLIFSSPAIED 173

  Fly   423 LNEPHRIKSLRHQILNNLEDYIS 445
            |::...:      :|::.:.|.|
 Worm   174 LSDTGNL------LLSSFQSYYS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518
NR_LBD_HNF4_like 264..494 CDD:132729 27/153 (18%)
nhr-282NP_001370053.1 HOLI 71..219 CDD:214658 27/153 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.